KEGG   Bradyrhizobium oligotrophicum: S58_48200Help
Entry
S58_48200         CDS       T02484                                 

Definition
(GenBank) putative L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00260  Glycine, serine and threonine metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
aol01120  Microbial metabolism in diverse environments
aol01130  Biosynthesis of antibiotics
aol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S58_48200
Enzymes [BR:aol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     S58_48200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAM90799
UniProt: M4ZAM3
Position
5447487..5448554
Genome map
AA seq 355 aa AA seqDB search
MYYTPPPRDPKAPPVRVNLLSDTQTRPTPAMREAIARAEVGDEQIGDDPTVHELTARVAA
LLGKEAAVLMPSGTMCNVTATLVHCRPGDEILAHETAHIISREGGAHAALGGFQVTQLKG
PDGQFTPETFRAALHPRSRYQPPQTVVSVEQTANIGGGTIWKKAALDEIVAIAKAQGMAT
HMDGARLLNATVATGIPAADMAAGWDSAWIDFSKGLGAPIGGVLAGSAAFIDEVWRWKQR
LGGAMRQAGVVAAACIYALDHHVDRLADDHANARALARGLSQIQGVEVQEPETNLVFFKP
DGAGVSGEKMVSGLRKRGVLLAMMDGRIRACTHLDVTSAMIEETIGHVREIVRGA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaccccgcccccgcgcgatcccaaggcgccgcccgtgcgcgtcaacctgttg
tcggatacgcagacccggcctaccccggcgatgcgcgaggcgatcgcgcgggcggaggtc
ggcgacgagcagatcggcgacgatccgaccgtgcacgagctcaccgcccgcgtcgccgcc
ctgctcggcaaggaagccgcggtgctaatgccgtcgggcacgatgtgcaacgttacggcg
acactggtgcattgccggccgggcgacgagatcctggcgcacgagaccgcgcacatcatc
tcgcgcgagggcggcgcgcatgcggcgctgggcggtttccaggtcacgcagctgaagggc
cctgacgggcagttcacgccggagacgttccgcgccgcgctgcatccgcgcagccgctac
cagccgccgcagacggtcgtcagcgtcgagcagaccgccaatatcggcggcggcacgatc
tggaagaaggccgcgctcgacgagatcgtcgcgatcgccaaggcccagggcatggcgacg
catatggacggcgcgcggctgctcaatgccaccgtcgccaccggcattccggcggccgac
atggcggcaggctgggattcggcctggatcgatttttccaaggggctcggcgcgccgatc
ggcggcgtgctcgccggcagcgccgccttcatcgacgaggtctggcgctggaaacagcgg
ctcggcggcgcaatgcgccaggccggcgtggtcgccgcagcctgcatctacgcgctggac
caccatgtcgaccggctggccgacgatcacgccaatgcgcgcgcgctggcgcgcggcctg
tcgcagatccagggcgtcgaggtgcaggagcccgagaccaatctcgtgttcttcaagccg
gatggcgcaggcgtcagcggcgagaagatggtgagcggactccgcaagcgcggcgtgctg
ctggccatgatggacggccgcatccgcgcctgcacccatctcgacgtgacctcggcgatg
atcgaagagaccatcggccatgtccgggagatcgtgcgcggcgcttaa

DBGET integrated database retrieval system