KEGG   Bradyrhizobium oligotrophicum: S58_50800Help
Entry
S58_50800         CDS       T02484                                 

Definition
(GenBank) putative amidotransferase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00330  Arginine and proline metabolism
aol00360  Phenylalanine metabolism
aol00380  Tryptophan metabolism
aol00627  Aminobenzoate degradation
aol00643  Styrene degradation
aol01100  Metabolic pathways
aol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    S58_50800
   00360 Phenylalanine metabolism
    S58_50800
   00380 Tryptophan metabolism
    S58_50800
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    S58_50800
   00643 Styrene degradation
    S58_50800
Enzymes [BR:aol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     S58_50800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAM91059
UniProt: M4ZBB9
Position
5753744..5755165
Genome map
AA seq 473 aa AA seqDB search
MADQGLIRETACTVVDKLKSGEVTPLDCLDALEVRINAVDDKVNALPTLCFDRARDHAKA
LMSKPANARGLLAGLPVPIKDLTDVAGVLTTQGSPIFKDRIPERSDLLVEHLEANGGVIY
AKSNTPEFGAGANTFNEVFGATRNPWDTSRSAAGSSGGAAVALATGMAWLAHGSDMGGSL
RNPASFCGIVGLRPSFGRVAQTPTTAVDRNLGVQGPMARNVEDLALLLDAMSGEYPADPI
SLPSPAISFLAAARSGRKPIRVAYSPDLGITPVDPEVAAVTRKAAQRFAELGVIVEEAHP
DFSEAHECFHVLRALDFAMSKAELLRTKREQLKPEVIWNVEEGLKLTVAQITRAEAQRVA
ITARAVKFFETYDLLLAPATIVPPFPVENRYVAECAGRKFDNYVQWLGIVYAITLACCPA
LSLPCGFTETGLPVGLQMIAAPRADARLLAGAKVLEDVLGIANSTPIDPRAPR
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttggccgaccagggattgatccgcgagaccgcctgcaccgtcgtcgacaagttgaagtcc
ggcgaggtcacgccgctcgattgcctggatgcgctggaagtgcgcatcaacgccgtcgac
gacaaggtcaatgcgctgccgaccctgtgcttcgatcgcgcgcgcgatcacgccaaggcg
ctgatgagcaagccggccaatgcgcgcgggctgctcgccggcctccccgtcccgatcaag
gatctcaccgacgtcgccggcgtgctgaccacgcagggctcgccgatcttcaaggaccgg
attccggaacgctccgatctcctggtggagcatctcgaagccaatggcggcgtgatctac
gccaagtcgaacacgccggagttcggcgccggcgccaacaccttcaacgaggtgttcggg
gcgacgcgcaatccctgggacacgtcccgctcggcagctggctcatcgggtggcgcggcg
gtcgcgctcgcgaccggcatggcgtggctcgcgcatggctccgacatgggcggctcgctg
cgcaatcccgcgagcttctgcggcatcgtcggcctgcgtccgagcttcggccgcgtcgca
cagacgccgaccacggccgtcgaccgcaacctcggcgtccagggcccgatggcccgcaac
gtcgaggaccttgcgctgctgctggacgcgatgagcggtgagtatcccgccgatccgatc
tcgctgccctcgcccgcgatctcgtttctggcggccgcccgctccggcaggaagccaatc
cgcgtcgcctactcgcccgatctcggcatcacgcctgtcgatcccgaagtcgccgcggtg
acccgcaaggcggcgcagcgttttgccgagctcggggtgatcgtcgaggaggcgcatccg
gatttcagcgaggcgcacgaatgcttccacgtgctgcgcgcgctcgacttcgccatgagc
aaggccgagctgttgcgcaccaagcgcgagcagttgaagcccgaggtgatctggaacgtc
gaggaagggctgaagctcaccgtcgcgcagatcacccgcgccgaagcgcagcgcgtggcg
atcacggcgcgcgccgtgaaattcttcgagacctatgacctgctgctggcgcccgcgacc
atcgtgccgcccttcccggtcgagaaccgctacgtcgccgaatgcgccgggcggaagttc
gacaactacgtgcagtggctcggcatcgtctacgcgatcaccttggcctgctgcccggcg
ctgtcgctgccctgcggcttcacggaaactggcctgccggtcggattgcagatgatcgcg
gcgccgcgcgccgacgccaggctgctcgccggcgccaaggtgctggaagatgttctcggc
attgccaactcgaccccgatcgatccgcgcgcgccgaggtga

DBGET integrated database retrieval system