KEGG   Bradyrhizobium oligotrophicum: S58_58950Help
Entry
S58_58950         CDS       T02484                                 

Definition
(GenBank) Mg-protoporphyrin IX methyl transferase
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
aol  Bradyrhizobium oligotrophicum
Pathway
aol00860  Porphyrin and chlorophyll metabolism
aol01100  Metabolic pathways
aol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aol00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    S58_58950
Enzymes [BR:aol01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     S58_58950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_12 Cons_hypoth95 MTS CMAS PrmA Ubie_methyltran PCMT FtsJ UPF0020 Methyltransf_18 MethyltransfD12 Met_10 Methyltransf_15 tRNA_U5-meth_tr TPMT Methyltransf_9 RrnaAD TehB Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: BAM91872
UniProt: M4ZDI3
Position
complement(6673557..6674258)
Genome map
AA seq 233 aa AA seqDB search
MSTAEYLARRSEVETYFDRTAVAAWTRLTSDAPVGRIRATVRAGRDEMRRTLLSWLPLDL
RGARILDAGCGTGSFSIEAARRGAEVVAVDISPTLIEIAQRRLPDDISRNAIRFVAGDML
DPRHGGFNFVVAMDSFIHYRAEDAVRIVAGLAARTSESILMTYAPRTPLLAVMHAIGGVF
PRGNRAPAIEPVTEQKLYRLIADHPDLADWRCARNCRVANGFYISQALELRPS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcggaatatctcgcccgccgcagtgaagtggagacctatttcgaccgcacc
gcagtcgccgcctggacgcggctgacctcggatgcgccggtgggacgcatccgcgccact
gtgcgtgccggccgcgacgagatgcggcggacgctgctgtcgtggttgccgctcgacctg
cgtggcgcgcgcatcctcgatgccggctgcggcaccggcagcttctccatcgaggctgcg
cggcgcggcgccgaggtggttgccgtcgacatctcgccgaccctgatcgagatcgcgcag
cgccggctgcccgacgacatcagccgcaacgcgatccgcttcgtcgccggcgacatgctc
gatccccggcacggcggcttcaatttcgtggtggcgatggattcgttcatccattaccgc
gccgaggacgccgtccgcatcgtggcgggccttgccgcgcgcacctccgaatcgatcctg
atgacctacgcgccgcgcacgccgctgctcgccgtcatgcacgcgatcggcggcgtgttc
ccacgcggcaatcgcgcgccggcgatcgagcctgtgaccgaacagaagctgtatcgcctc
atcgccgatcatcccgatctcgccgactggcgctgcgcccgcaactgccgcgtcgccaac
ggcttctacatctcgcaagcgctggagcttcgcccgtcatga

DBGET integrated database retrieval system