KEGG   Aquabacterium olei: DEH84_00600Help
Entry
DEH84_00600       CDS       T05429                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
aon  Aquabacterium olei
Brite
KEGG Orthology (KO) [BR:aon00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DEH84_00600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF11
Motif
Other DBs
NCBI-ProteinID: AWI52111
UniProt: A0A2U8FM38
Position
complement(146627..147001)
Genome map
AA seq 124 aa AA seqDB search
MSLPEFTCSVRPEYLAEQSNPSRNEYAFSYTVTIRNTGAVTAQLVARQWLITDATGRTQE
VRGLAVVGHQPVLKPGEQFEYTSWTSLDTPHGVMQGTFYCMTEDARPFEAPIAPFTLARS
QSLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcctgaattcacctgctccgtccggcccgagtacctggccgagcagagcaac
cccagccgcaacgagtatgcgttcagctacacggtcaccatccgcaacaccggggcggtg
acggcgcagctggtggcgcggcaatggctgatcaccgatgccacgggccgcacccaggag
gtgcgcgggctggccgtggtggggcaccagccggtgctgaagccgggcgagcagttcgaa
tacacgagctggaccagcctggacaccccgcatggcgtgatgcagggcaccttctattgc
atgaccgaggacgcccgcccgttcgaggcgcccattgcgccgttcacgctggcgcggtct
caatcgcttcattga

DBGET integrated database retrieval system