KEGG   Aquabacterium olei: DEH84_09750Help
Entry
DEH84_09750       CDS       T05429                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
aon  Aquabacterium olei
Brite
KEGG Orthology (KO) [BR:aon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aon03016]
    DEH84_09750
Enzymes [BR:aon01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     DEH84_09750
Transfer RNA biogenesis [BR:aon03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    DEH84_09750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AWI53687
UniProt: A0A2U8FS28
Position
complement(2151711..2152457)
Genome map
AA seq 248 aa AA seqDB search
MTTSAPLPILWRDEHLVALHKPPGWLVHRTGLDADESRVVLQALRDQIGRHVYPVHRLDK
GTSGVLLMALNSEVAGRLGGAWHEGAVRKLYVAMVRGWASEATTVDHPLVPDESPEGTPA
QPARTHIRRLARLSLPIPVDRYDTTRVSLVQAEPETGRRHQIRRHLKHLSYPLIGDATHG
KGAHNRWWAERLGVQRLWLHAAELALSHPMTGQPMRFHSPWHPDHPDAAVLNPDWAALIR
SEAWQWGD
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcggcgccgttgcccatcctgtggcgcgacgaacacctcgtggcgctgcac
aagccacccggctggctggtgcaccgcaccggcctggatgcagacgagtcccgcgtggtg
ctgcaggccttgcgcgaccagatcgggcgacacgtttatcccgtgcaccggctggacaag
ggcacctcgggcgtgctgttgatggcgctgaactcagaggtggcaggccggctgggtggc
gcctggcatgaaggcgccgtgcgcaagctgtatgtggccatggtgcgcggttgggcctcc
gaagccaccacggtggaccatccactcgtgcccgacgagtctcccgagggcaccccggcg
cagcccgcacgcacgcacatccgccgcctcgcccggctcagcctcccgattccggtcgac
cgctatgacaccacgcgtgtcagcctggtgcaggccgagccggaaaccggacgtcgccac
cagatccgtcgccacctcaagcacctgtcgtacccgttgatcggcgatgccacgcatggc
aagggggcgcataaccgctggtgggccgaacgtctgggtgtgcagcgcctgtggctgcac
gccgcggaacttgctctgagccacccgatgaccgggcagccgatgcgctttcattcgccc
tggcatccggatcatccggacgcggcggtgctgaaccccgattgggctgcgttgatccgc
agcgaagcctggcagtggggcgactga

DBGET integrated database retrieval system