KEGG   Aquabacterium olei: DEH84_16160Help
Entry
DEH84_16160       CDS       T05429                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
aon  Aquabacterium olei
Pathway
aon00450  Selenocompound metabolism
aon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DEH84_16160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aon03016]
    DEH84_16160
Enzymes [BR:aon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     DEH84_16160
Transfer RNA biogenesis [BR:aon03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    DEH84_16160
 Prokaryotic Type
    DEH84_16160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AWI54779
UniProt: A0A2U8FUN2
Position
complement(3594058..3595110)
Genome map
AA seq 350 aa AA seqDB search
MMSIALTQFSHGGGCGCKIAPGLLSEILSRAPQGLVPPELMVGLETSDDAAVYRLNDQQA
LVATTDFFTPIVDDPRDFGRIAATNALSDIYAMGGTPIMALALVGMPIAKLPPEVIGQIL
GGGAEVCRAAGIPIAGGHSIDLLEPIYGLVALGLVHPDRVRRNADGRAGDVLVLGKPLGV
GVLSAALKKGRLDEAGYAQMIRHTTQLNRVGVALGALPGVHAMTDVTGFGLAGHLLEVCR
GSGLDAQVTLSQLPLIEVAAGFAREGIVTGASGRNWAAYGAEVNWPAHAQAWQQALVSDP
QTSGGLLVSCAPEAVPAVLAAMQAEGCGEAAVIGTLAAPAQAGAPRLHFA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccattgcgctgacccagttctctcacggtggcggctgcggctgcaagatcgcc
ccgggcctcctgtccgagattttgtcacgggccccccagggcctcgtgccgcccgagctc
atggtcggcctggagaccagcgacgacgcggccgtctaccggctcaacgaccagcaggca
ttggtggccaccaccgatttcttcacccccatcgtcgacgacccgcgggatttcggtcgc
attgcggccaccaacgcgctgtcggacatctatgccatgggcggcacgcccatcatggcg
ctggcgctggtcggcatgccgatcgccaagctgccgcccgaggtgatcggccagattctg
ggcggtggcgccgaggtgtgccgggcggcgggcatccccatcgccggcgggcattccatc
gacctgctcgagccgatctacggcctggtggccctgggactggtgcaccctgaccgcgtg
cgccgcaatgccgatggccgcgcgggcgacgtgctggtgctgggcaaaccgctgggtgtg
ggcgtgctgtcggccgcgctcaagaaagggcggctggatgaggcaggctatgcacagatg
atccgccacaccacgcagctcaaccgggtcggtgtggcgctgggcgcgctgcccggtgtg
cacgcgatgacggacgtgacgggcttcggcctggccggccacctgctcgaggtgtgccgc
ggctcggggctggatgcgcaggtgacgctgtcgcagctgccgttgatcgaggtggccgcc
ggctttgcgcgcgaaggcatcgtgaccggggcgtcgggccgcaactgggcggcttatggc
gccgaggtgaactggccggcccacgcccaggcctggcaacaggccctggtgtccgacccg
cagaccagcggcggcctgctcgtgagctgcgcgcccgaggccgtgcccgccgtgctggcc
gccatgcaggccgagggctgtggcgaggcggccgtgatcggcacgctggccgcccccgcg
caggccggcgcaccccgcctgcatttcgcctga

DBGET integrated database retrieval system