KEGG   Aspergillus oryzae: AO090001000378
Entry
AO090001000378    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K17769  mitochondrial import receptor subunit TOM22
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aor03029]
    AO090001000378
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aor02000]
    AO090001000378
Mitochondrial biogenesis [BR:aor03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    AO090001000378
Transporters [BR:aor02000]
 Other transporters
  Primary active transporters [TC:3]
   AO090001000378
SSDB
Motif
Pfam: Tom22
Other DBs
NCBI-GeneID: 5990875
NCBI-ProteinID: XP_001818904
UniProt: Q2UNG3
Position
2
AA seq 153 aa
MVQLQEVEDEHYAQEKPQVTKNNVLLASDDEDDDYTDTESEISEDSDIELDGETFYERLS
ALKDMIPPSARRQVNNTVSSITSFTKSSLMFSGRALWVISTSAFLVGIPFALAYAEEEQY
VQMEREQGMIKGANEMLTPGAISEEQKQAQPTL
NT seq 462 nt   +upstreamnt  +downstreamnt
atggttcagcttcaagaagtcgaggacgaacactacgcccaggagaagccccaggtcacc
aagaacaacgttcttcttgcctcggacgacgaagatgatgactacactgataccgagtct
gaaatatccgaggactccgatatcgagctcgacggcgagaccttctacgagcgtctgtcc
gctctgaaagacatgatccctccctccgcccgccgccaggtcaacaacacagtttcctcc
atcacctcattcacaaagtccagtctcatgttcagcggtcgggcactctgggttatcagc
accagtgctttccttgtcggtatcccattcgcgctcgcctatgcggaggaggagcagtac
gttcagatggagcgtgagcagggcatgatcaagggtgccaacgagatgctcacccccggt
gcgatttccgaggagcagaagcaggctcaacctactctgtaa

DBGET integrated database retrieval system