KEGG   Aspergillus oryzae: AO090001000528
Entry
AO090001000528    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ankyrin repeat
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 AAA_16 NACHT AAA_22
Other DBs
NCBI-GeneID: 10099705
NCBI-ProteinID: XP_023089699
Position
2
AA seq 1197 aa
MATGIAMGRPSPQLDNSEYAVGWIAALLHERAAAKAMLDIVHAPPRHKHAKDHNSYTLGS
INGPNGEHNVVIASLPSGRYGTVTAATAAKQMLSSFPSIKFGLMVGIGGGIPSDDHDIRL
GDVVVSQPTGAFGGVRQYDCGKVTARGFEECGALNCPPEALLNAMGELQSNHEMMGGTSI
PDILESMYAAYPAMADSRRGPAYIYQGADHDRLFCSDCIHEKGAKDCGGCNPEKEIKRPE
RLDQDPYIHYGTIASGNKVIKDAKVRDLLAKSCLCFEMEAAGLMNQFPCLVIRGICDYCD
THKNDRWQKYAAATAAAYAKELLQVTDASDIQNTPEARSVVMDNSELQLFLVLLRLICSQ
FSEIKTIVKGLARDQEQKDLFRWLSPLSPSARHSENQRVRVEGTSVWILEDPRFLDWSGE
GPSSQALCCFGNPGAGKTIISSVVIDSIRGQITTDSTIGLAYLYGDYRDHKVQTTENILG
AIVKQLLVFLSEIPQALLELYQREAKQEAPLSKVSAQTFLDVACEQFSKVYICIDAVDEL
KDQRTLLECLQGRSSMQLFITGRPHIRQTVQKYLKQRQEIPIEAHEGDIRRFIDREIGGP
NDIEPDAMDEKLRLDIQSKVLASAKGIFLLPVLQVHAVLQAATMRRREEALKTLPSSLSG
AFSGTVARIEQQPIAHSAKAKTIIAWVHLAERPVSVDELLCSLAIEDGDKAFNRRGIPVR
STLLSCCHGLVVIDQETHTVRLVHYSFQEYLNQQSKMFGLSKEEWHSQIARTCLTFLNFP
EETADDYMGITLLSYAATKWGHHLRRSEYLPDSPLELAKKYLSTAQVFNNASLLLLYREM
YTGRHKDHELHRVVTLAHIAAFFGIHSIMLHLTVTVDIDSRDIIGYTPLSWAANLGHMPI
VKLLIEQGVSVDPQDLNGMTPLFLALKSKHEWIAELLIDYGAAVDVNDENRNTPLSYAVE
YKCETAVRLLLDKGAPVDTKNKFGETPLLIAAHGGFERIVELLLERGAEVDSMDPYGRTP
LLYAAISGFEKIVRLLLAKNAAVDSLDHKYGRTPLLWAIAKDHEAIARLLIDKGAAVDTV
DATYGWTPLIWAAYHGWETIARLLIEKGAAIDSVDSKYGRTPLLLALEYRHEAVVKLLLS
NGAAALMDSGGNFDLATWKGDGGLDGLMDHLGLTMDDLGHRLRRRTSRKPTYLEYFT
NT seq 3594 nt   +upstreamnt  +downstreamnt
atggctaccggaatagcgatgggtcgcccatcaccgcaactggacaactccgagtatgcc
gtcggctggatcgctgccttgctacatgaaagagcagctgccaaggcaatgcttgacata
gtgcatgcgccgccgcggcacaaacacgccaaagatcacaatagctatacgttaggctct
atcaatggaccaaatggggaacataacgtggttattgccagcctcccgtccggtcgatat
ggaaccgtaactgcggctacggctgctaagcagatgctttctagttttcccagtatcaag
tttgggctaatggttggcattggcggtggtatcccgagcgatgatcatgacatccgactg
ggcgacgttgtggttagtcaacctacaggcgcatttggaggcgtaaggcaatatgattgc
ggcaaggtcactgcgcgtggtttcgaagagtgtggtgcactgaactgtcctcctgaggcc
cttttaaatgcgatgggtgagcttcaaagcaaccacgagatgatgggaggcacatcgata
cccgatatcttggagtccatgtatgcagcttatccggcaatggcggattcacgaagagga
ccagcatatatctatcagggtgcagatcatgatcggttgttctgctctgattgtatacat
gagaagggcgcaaaagattgtggtgggtgtaatcccgagaaggaaatcaaacgacctgaa
cgactggaccaggatccttatatccactatggcactatcgcttcaggtaataaggtcatc
aaggatgcgaaggtgcgcgatttgctagcaaagagttgtctttgttttgaaatggaagcc
gcgggattgatgaaccaatttccatgtctcgtcattcgtgggatctgtgactattgcgat
acccataaaaatgatcgatggcagaagtatgcggcggctactgctgctgcgtatgcaaaa
gagcttcttcaggttaccgacgcctcggacatccaaaatacaccagaagcccgtagtgtt
gttatggataacagtgagttgcagctcttccttgtattactgagactcatttgttctcaa
ttttcagagatcaaaacaattgtcaagggcctcgcccgagatcaagaacagaaagatctg
tttaggtggctatctcctctcagcccgtctgctaggcattctgagaaccagagagtgcga
gtggaaggtactagtgtatggattcttgaggatcctaggttcttagattggtctggtgaa
ggccccagctcccaggccctgtgctgctttggtaacccaggcgcaggtaaaacgattata
tcctctgtcgtgattgacagcataaggggccaaataacaaccgactcgactattggacta
gcatacctatacggtgattatcgtgaccataaagtccagacgacagagaatattcttggg
gccattgtaaaacagctattagtgttcttatcggagattccacaggctcttctggaacta
taccagagagaagcaaagcaggaggccccgctgagcaaggtcagcgcgcagacgttccta
gacgtagcttgcgagcagtttagcaaagtttatatctgcatcgatgcagtggatgaattg
aaggatcagagaactcttttagagtgcttgcaaggtagatcttctatgcagttgttcatt
accggtcgtccgcatatccggcaaactgttcaaaaatacctcaagcagaggcaagagatc
cccattgaagcccacgaaggcgatattcgacgattcattgatcgtgagattggtgggccc
aatgacattgaacccgatgctatggatgagaaattaagactcgatatccagagcaaagtc
ctcgcatcagcgaagggaatctttctcttacccgtattgcaagtgcacgctgtccttcag
gccgcaactatgcgtcgtcgtgaggaagctttgaaaacgttgccatctagtcttagcggt
gctttctctggtaccgtagctcgtatagagcaacaaccgattgcacattcagcaaaggca
aaaacgattattgcttgggttcatttagcagaacggcctgtcagcgttgatgaacttctt
tgttccctcgcaatcgaagacggggataaggcttttaaccggagaggcataccggtcaga
agtacgcttctaagctgctgtcatggactagtggttattgaccaagaaactcatactgta
cgcttggtccattattctttccaagagtatctcaatcaacaaagcaagatgttcgggctt
agcaaagaagagtggcacagtcaaattgcacgtacatgtcttacattcctaaatttcccg
gaggagaccgcagacgattatatgggtatcacgcttctgtcctatgctgctaccaaatgg
ggccatcaccttcgaagaagtgagtacttaccagactcacctttagagctcgcaaagaaa
tacctcagcactgcacaggtattcaacaatgcaagtttgcttctactgtatagggaaatg
tacacaggtcgtcacaaagaccatgagctgcacagggtagtcaccttagctcatatagca
gctttctttggcatacacagcattatgcttcatttgactgtgactgttgacattgactca
agggatataatcggctatacgccattatcctgggccgcaaaccttggacatatgccaata
gtgaaactacttatcgagcaaggtgtttcagtggaccctcaagatttgaacggcatgaca
cctctttttctagctcttaaatccaaacacgaatggatagcagagctgctgatagattac
ggcgctgcagtggacgtgaatgacgagaacagaaatacaccgctgtcatatgctgtggaa
tataaatgtgagacggcagtgaggctactcctggataaaggcgcaccagtggataccaag
aataagtttggggaaactccactcttaatcgccgctcatggcgggttcgagagaatagta
gaattgctgcttgaacgtggtgctgaagtggattcaatggacccgtacggccgaactcct
ttgctatacgctgcaataagtggatttgagaaaatagttagattacttcttgcgaaaaat
gcggccgtggactcattagaccataaatatggccgcaccccactgttatgggccatcgcg
aaagatcatgaggcaatagcaaggttattaattgataaaggtgctgcagtggatacggtg
gacgctacatatggctggacacccttgatatgggctgcatatcatggatgggagacaatt
gcacggttgctgatcgaaaaaggggcagcaatcgattccgtggactctaaatacggccgg
acaccactgctattggcattagagtacagacatgaggcggtagtgaaactgctgctcagc
aacggtgctgctgcattgatggactcgggtgggaactttgatctcgcaacatggaaggga
gatggaggcctagatggcttgatggatcatctagggctaacaatggatgatcttggacat
cgtttgagaaggagaacaagtcggaagcctacttatctcgaatactttacctag

DBGET integrated database retrieval system