KEGG   Aspergillus oryzae: AO090003000221
Entry
AO090003000221    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Other DBs
NCBI-GeneID: 5991418
NCBI-ProteinID: XP_023089876
Position
2
AA seq 431 aa
MAPFGETIAVIDKSGKVVSTSKQLFGVFSNAKNAYSARKAQFQSERNAIIAEREALKAIQ
NYTIDDAPSVASSRRSRSRHHSGRSHHARHYYDDDYEYEQDRGSVASRPDSYYDRPQDLV
RRHTHHDIAMRGPEARPTTSRSKSDAHIDMDLAYGDYNPHVLTKAPPQQNQLQKIEDPEL
SGLVNRAQWLMEEANCVHHSATATIAHLQKNPDAMAAVALTLAEISKIASKMAPAALSSL
KSAAPAVFALLASPQFLIAAGVGLTATIVMFGGYKIIKQMSGNGNEVSRGPDRGLGPRPG
ESVGMDDMVEINTECLSGVEMWRRGVADAADESIGTSVDGEFITPTAAMMSGIDVTTARM
MRDPRFKFDDEESRASSHRSHRSRPPRSRAPTRLDERPESYVASKAPTKSFFGAIESPKQ
SSIEGTLPSSI
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggccccgttcggcgagaccattgccgtgattgataagtccggcaaggtagtgagtacg
agcaagcaattgtttggtgttttcagcaatgccaagaatgcatatagcgcccgcaaggcc
caattccaatcagagcggaatgctattatcgccgaaagagaagctctgaaggcgatacaa
aattatacgattgacgatgcgccctccgtcgcctcttcgcggagaagtcgttcgcgacac
cattcgggccgcagccaccatgcccggcactactacgacgacgactatgaatatgagcag
gaccgcggttccgttgcgtcgcgcccggattcttactatgaccgcccacaggacctagtc
cgtcgacatacccatcatgatatcgccatgcgggggcccgaagctcgaccgacaactagt
cgctcaaagtcagatgcacacatcgacatggacctggcgtacggcgactacaatcctcac
gtgttgaccaaggctccgccacaacaaaaccaactgcagaagattgaggacccagaacta
agtggtctagtaaaccgcgcacaatggctcatggaggaagccaactgtgtacatcatagt
gccacggccacgattgctcatcttcagaagaatcccgatgccatggccgcagttgcactc
accctggccgagatcagtaaaatagcctcgaagatggccccggccgcactttcgtcgctc
aaatcggcagcccctgccgttttcgcactgcttgccagcccgcagtttctcatcgccgcc
ggtgttggtctcactgcgacaattgtcatgtttggcggctacaaaatcatcaagcaaatg
tccggtaacggtaacgaagtcagtcgaggaccagaccgcgggctcggccctcgaccgggt
gagtccgtcggtatggatgacatggtagagatcaacaccgaatgcctcagcggtgttgaa
atgtggcgacgtggtgtcgccgatgcagccgatgagagcatcggcacctctgtcgatggt
gaattcatcaccccaactgctgctatgatgtccggcatcgatgtgaccactgcacgcatg
atgcgggaccctcgtttcaagttcgacgacgaggaatcgagggcatcatctcaccggtct
catcgttcacgccccccaagatctcgcgcgcctacccgattggatgaaaggccagagtca
tacgtggcttccaaggcaccgactaagtccttcttcggcgccatcgagagccccaagcaa
agctccatcgaaggcaccctcccgagctccatctag

DBGET integrated database retrieval system