KEGG   Aspergillus oryzae: AO090003000551
Entry
AO090003000551    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Fungal_trans Zn_clus
Other DBs
NCBI-GeneID: 5991702
NCBI-ProteinID: XP_023090001
Position
2
AA seq 859 aa
MDAPSNHPQRGDDSSQSEIPPQHSFDTQNEVMIASKPPASHTSQLLNVPPRSSLPGKKQY
KNAKVAIPRQRTSVVPGYSRRVPLACESCRGRKTKCSGDTPVCRQCKELRVTCKYPASWR
ERTKGQLDSLSTKAEAYEKLLRDIGNIVDGRTAEQIRVTLDKVCALCHYSGSGGERASTG
SQSSSATPQDKDSYLEEMSSSSSIGSLDAIDRVEEDVNRTPNSRATGYMGKNSEVTWMQR
LRMETEQRLRKEPGPYEAEPEGEFALHSMNYHLDDLDVSVPGPVQVYWIPPRPLADKLFE
DYLETVHPFYPIISRTLFRAQYRTFFDSTARPGDKWLAILNLIFAISAKHAHLTQAPWRG
DDNDHLVHPDLQQVQVEGLVAFYLMASDQINRAWKITALAVRSAISLGLNMKNTSESTPG
ISKEARYRVWWCVYTFEHMLGIMTGRVSCITDGICTTPLPLPFEEDQLREPAAAKLLNDQ
DLRQELVESALASTLVRHMPSNPTGGKEARHTDKLRDAAWLKSQPASKTLIFLYYVDLAV
VAQEIVNRVYSLDCAMVPWRHIENRIGELRSRIDIWYTNLPEALDFTRRDDQGTDMLRGK
LFLAFHYYSARITLGRPCLCRRDARHTSPQQKPSFSHEMAEITLNSARQMLDLIPDEPNA
VQLYHVCPWWCVLHYLMQTATVLLLELSFGCIHMPAEERGIFEASKKAIRWLFAMSECSL
PARRAWELCDSNLRRIAIGMDYDLSDLPALNFNPTSHVHMASNTGGNAGMGVSVSQTAPP
MPIFYDTVGGPNQHPVQTQYHYDQNQQAYSGVPALDPISTTLALSASGTDAFFPYDPISG
EFIRSFFPIPNEEEPWEQN
NT seq 2580 nt   +upstreamnt  +downstreamnt
atggacgcaccttccaatcaccctcagcgaggtgacgacagctcgcagagtgaaatcccc
ccccagcactctttcgatactcaaaatgaagttatgatcgcctcgaagcctccagcctcg
catacttcgcaactgttgaatgtacctccccggagcagcttacccggcaagaagcaatat
aagaatgcgaaagtggccatcccgcggcagagaacgagtgtcgttcctggttacagtcga
cgtgtgcctcttgcctgcgaatcctgtcgggggcggaagactaagtgtagtggcgacacg
ccggtttgcagacagtgcaaagaattgagggtgacttgtaagtatccggcatcatggagg
gaacgaaccaaagggcaattggacagtctctcgacaaaggccgaagcgtatgagaagctc
ttgagagacattgggaatattgtcgatggcaggactgcagaacaaattagagtcactctg
gataaggtctgtgcgctttgccattattctggttcgggtggcgagcgggcttctactggc
tcgcaatccagctcagctacgccgcaggataaagacagctaccttgaagaaatgagctcc
tcctcttctattggatccctagacgccatcgaccgcgtggaagaggatgtaaatcgaact
ccgaattctcgagctacaggttacatggggaagaattcagaggttacctggatgcagaga
ttgcgaatggagacagaacaacgcctccggaaagaaccagggccctatgaagctgagccc
gagggagaattcgccctacactcgatgaactatcatttggacgatctagatgtctcggtt
cctggccctgtgcaggtgtattggatccctcctcgccctttggcagacaagttatttgaa
gactacttggaaacggtgcacccgttttatcctatcatcagccgtacactgttccgcgcc
caatacagaaccttctttgacagtactgctcggcctggcgataaatggctggccatcctt
aacttgatattcgcgatctccgccaaacatgctcatttaacgcaggcaccgtggcgtggc
gatgacaacgatcatttagtccatcccgatcttcagcaagtgcaggtcgagggcttggtt
gctttttatcttatggcatcagaccaaatcaaccgagcttggaagatcaccgcgttggct
gttcgttcggcaatctcactcgggttgaatatgaagaacacaagcgaaagcacgcctggt
atctcaaaggaggcgcgatatagggtctggtggtgtgtctatacttttgaacatatgctt
gggatcatgacgggcagagtttcttgcatcacggatgggatatgtacaacaccgttgcct
ctaccgttcgaggaagaccaactccgagagccagctgcggctaagcttctcaacgatcaa
gaccttcgccaggagctggtggaatcggctttggcaagcaccctcgttcgccacatgccc
tcaaatcccacgggaggtaaggaggctcgacatacagacaaactgcgtgacgctgcttgg
ctgaagagtcaacccgccagtaagacgcttatatttctgtattatgtggacctggcagtt
gtcgctcaggaaatcgtcaaccgggtgtattcgctggactgtgccatggtaccttggagg
cacatcgagaaccgcattggggagcttcgatcccgaattgacatatggtacaccaacctt
ccggaggctttggacttcacccggcgggacgaccaaggtacggatatgcttcgtggaaag
cttttcttggcgttccactactacagtgctcgaatcaccttggggcgtccgtgcctgtgt
cgccgcgatgctcggcacactagccctcagcaaaaaccctcttttagccatgaaatggca
gagataactctaaattctgcacggcagatgctggacttgattccagacgaacctaacgct
gtccaactctaccatgtttgtccttggtggtgcgttctgcactatctcatgcagacggct
acagttctcctgctcgagttgtcgttcggttgcattcatatgccagccgaagagagaggt
atttttgaagcgtcaaaaaaagccatacgctggctttttgccatgtccgaatgtagtctc
ccagcacggcgtgcatgggaactgtgtgacagtaaccttcgacgaatcgccatcggcatg
gattatgacttaagtgaccttccagccctaaattttaacccaacctcgcacgtccatatg
gcctcaaatactggtggtaatgctggtatgggtgtatctgtcagccagacagcgccgcct
atgcctattttctacgacacagttggaggcccaaaccaacatccggttcagactcaatac
cattatgaccagaaccaacaagcgtactctggagtgccagcacttgatccgatttcgacg
acccttgcactttctgcttctggaactgatgcctttttcccttacgaccccatcagtggg
gagtttattcgctccttcttccccattcccaatgaagaggagccatgggaacaaaattaa

DBGET integrated database retrieval system