KEGG   Aspergillus oryzae: AO090003000596
Entry
AO090003000596    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Other DBs
NCBI-GeneID: 5991745
NCBI-ProteinID: XP_001819762
UniProt: Q2UL05
Position
2
AA seq 475 aa
MADSRRTPSISLTQYLPQDSGTPGRTDSLSISPPDSPVFLGHGPASLGSSRVSSLEDEFE
QYFGGGQTEKTFTSHIPVLRKHADNQREDPTPSFTRPATGWDTFSREPNNMDTFAPAAPG
CTFETHISSDARPIESRSSDVLNWGREQKRKLSGARSRPKESDLFLPPSSRVPWKGASGR
SPIVEPLQEKPRARSSSRVHLSRSSSQLRGRESPSPSGAYLGGYPSVVTTITGGEANTKV
PEMYVPSKNIHRTVFEDPTPPATSASSRAPPRVNLPEPDLTNTLADLKLTNEDDFGLPSS
RFSVTTYEPTEAGSSTATGSPRGSIDAASQSTEYQSSIMSRKRPVPSAVAPGKKPSRKPT
PSQTTNELLPCTPEQHTQNRIEMLEARRDYLTRRKASINTMIYELTQVIQPSPIAYDLAA
RDEVKKTVASLNNELADINKEEHDVGMKLFRAWRKRDEQECNGGSSGLWVKRVTS
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcggacagccgacgtacaccctcaattagtttgacgcaatacctccctcaggactcg
ggcacccccggtcgaacggatagtctttcaatatcacctcccgactcgccggttttcctt
ggccatgggcctgctagtctaggcagctctcgagtctcatccctagaggacgaattcgaa
cagtacttcgggggcggacagacggagaaaacattcaccagccacataccggttctgcgc
aaacacgcagataatcaacgagaagatcccactccttcgttcacgcgaccggctaccgga
tgggatacgttctcccgcgagccgaataacatggacacatttgcgcccgcggctcctggg
tgcacgttcgaaacacacatatcctccgatgctagacctatagagtctcgtagttcggac
gttctcaactggggccgagagcagaaaagaaagctctcaggagcccgtagccggccaaaa
gaaagtgacctcttcctcccgcctagttcacgagtgccttggaaaggtgccagtggaaga
tctccgatagtggaacctctgcaagaaaagccaagagccagatcctcatctcgtgtgcac
ttgtcgaggagttcctctcaattaagaggtcgagagagcccatcgcccagtggcgcatac
cttggtggttatccttccgtcgtcacgactatcacgggtggtgaagcaaacacgaaggtt
ccggagatgtatgtgccaagcaagaatatccaccgaacagtgtttgaggacccgacccct
cctgcgactagcgcaagcagccgtgctccgccacgcgtcaatctaccggagcctgatctc
accaatacccttgctgatttaaaactcaccaacgaagatgacttcggcctgccttcgagc
cgtttcagtgtaactacctacgagcctacagaagcaggcagttcaaccgcgacaggaagt
ccgcgagggagtatcgacgctgcttcccagtctaccgagtatcaatcttccatcatgtcc
agaaaacgtcccgttcccagcgcggtagctccggggaagaaaccgtcaaggaaacccacc
ccgtctcaaacaacgaacgaacttttgccttgcaccccagagcaacatacccaaaatcgc
atcgagatgttggaagcaaggagagactaccttacacgccgcaaagcaagcatcaatact
atgatttacgagttgacgcaagtcatccagcccagtcccattgcttacgatctggccgca
agggacgaggtcaagaaaacggtcgccagcttaaacaatgagctagctgatattaataaa
gaagaacacgatgttggcatgaaactattccgagcatggaggaagcgtgacgaacaggaa
tgcaatggtggcagcagtggtttatgggttaaacgagtgaccagctga

DBGET integrated database retrieval system