KEGG   Aspergillus oryzae: AO090003000611Help
Entry
AO090003000611    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
aor  Aspergillus oryzae
Pathway
aor00072  Synthesis and degradation of ketone bodies
aor00280  Valine, leucine and isoleucine degradation
aor00650  Butanoate metabolism
aor00900  Terpenoid backbone biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
Module
aor_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AO090003000611
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    AO090003000611
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AO090003000611
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AO090003000611
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     AO090003000611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N
Motif
Other DBs
NCBI-GeneID: 5991758
NCBI-ProteinID: XP_001819775
UniProt: Q2UKZ2
Position
2
AA seq 460 aa AA seqDB search
MSARPQNIGVKAIEVYFPKQCVEQTELEKFDGVSEGKYTIGLGQTKMSFCDDREDIYSVA
LTTLSSLFRKYNVDPKSVGRLEVGTETLLDKSKSVKSVLMQLFAESGNFNVEGVDNVNAC
YGGTNAVFNSINWLESSAWDGRDAVVVCGDIALYAEGPARPTGGAGCVALLIGPDAPIVF
EPGLRGSYVTHTYDFYKPDLTSEYPVVDGQHSLQCYTEAVDACYKAYAAREKTLKEKTQN
GTNGVAHDESKTPLDRFDYILFHSPTCKLVQKSYGRMLYNDFLENPTHPAFAEVAPELRD
LDYSKSLTDKNVEKTFMGLTKKRFAERVKPSLDVATLCGNMYTATVYAGLASLLSNVTFD
PSQPKRIGLFSYGSGLAASMFSAKIVGDVSYMAEKLDLHNRLNARDVLAPQAYVEMCALR
KQAHLKKNFKPSGNTETLFPNTYYLTEVDDMFRRKYEVKA
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcgtcctcagaacattggtgtcaaggccattgaggtctattttcctaagcaa
tgtgtcgaacaaaccgagctggagaagttcgacggtgtcagtgagggcaagtacacaatc
ggtctgggacagacaaaaatgagcttctgtgatgaccgtgaggatatctactctgtcgcc
ctgaccactctctcctccctctttcgcaaatacaacgtcgaccccaagtccgttggtcgt
ctcgaagtcggtactgagactctcctggacaaatccaagtccgtcaagtccgttctgatg
cagctctttgccgagagcggaaacttcaacgttgagggtgttgataacgtcaacgcttgc
tatggaggtaccaacgctgtcttcaacagcatcaactggcttgagtcttccgcctgggat
ggaagagatgccgttgttgtctgcggtgacattgctctgtatgccgagggacctgctcgc
cctactggtggtgctggctgtgttgccctcctcattggtcctgatgcccctattgtcttt
gagcccggtcttcgtggctcttacgtcacccacacctacgatttctacaagcctgatctc
accagcgaataccccgttgttgacggtcagcactcccttcagtgctacactgaggctgtt
gatgcttgctacaaggcctacgccgctcgcgagaagacgctgaaggaaaagactcagaac
ggaaccaacggtgtggcccatgatgaatccaagactcctttggaccgctttgactatatc
cttttccactcccctacctgcaagttggtccagaagtcgtacggccgtatgctttacaac
gatttcctcgagaaccccacccaccccgctttcgctgaagtcgctcctgagctgcgcgat
ctggactacagcaagtctctcactgacaagaacgtcgagaagactttcatgggtctgacc
aagaagcgcttcgctgagcgtgtgaagcccagccttgatgttgccactctctgtggtaac
atgtacaccgccaccgtctacgccggcctggccagcttgctcagcaacgtcaccttcgac
cccagccagcctaagcgcattggccttttctcctacggcagtggtctcgctgcttccatg
ttcagcgcgaagattgttggtgacgtgtcttacatggctgagaagcttgatcttcacaac
cgcctcaatgctagggatgtcttggccccccaggcctatgttgagatgtgtgctctgcgt
aagcaagctcacttgaagaagaacttcaagccctccggtaacacggagacgcttttcccc
aacacctactacctcactgaggtggacgacatgttccgccgcaagtacgaggtcaaggca
tga

DBGET integrated database retrieval system