KEGG   Aspergillus oryzae: AO090003000698Help
Entry
AO090003000698    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
aor  Aspergillus oryzae
Pathway
aor00970  Aminoacyl-tRNA biosynthesis
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AO090003000698
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aor03029]
    AO090003000698
Enzymes [BR:aor01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AO090003000698
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AO090003000698
Mitochondrial biogenesis [BR:aor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AO090003000698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 5991830
NCBI-ProteinID: XP_023090059
Position
2
AA seq 593 aa AA seqDB search
MLRPWLRQSTRAARSLPCCQCPRPYSSRLPTLTSPSSSVRRLQTSASESQDRVPLRKQLK
QNAKALKAEKRQRRESEEASRQKWELTVGIEIHAQLNTETKLFSRASTSSTDLPNSNVAL
FDLAFPGSQPEFQVPTLLPALRAALALNCDIQPVSRFDRKHYFYQDQPAGYQITQYYEPF
ARNGYVDLFGYDGIAPEDGDHVRIGIKQVQLEQDTAKSQEYHPSTQLLDFNRVSHPLVEI
ITMPQIHTPATAAACVRKIQAILQSCSAVTTGMELGGLRADVNVSIRQRGDTEGVHQYGG
IGGLGQRTEIKNLSSFKAVEDAIIAEKNRQIAVLESGGVVEGETRGWTIGSTETRRLRGK
EGEVDYRYMPDPDLPPLLIGADLVSELANTLPTSSDELIGLLTGKEYGLSIEDAKPLVEL
EDGARLEYYQDVVDILRDLQQDQDPKSRGGLARVAGNWVLHELGGLLTKADLPWDAERVS
ALSLAQIIDHVQRKQITGPTAKQVLAMVFDGDTRAIPQLLEEENLLLRPLSREEYVALAE
AAISQNPQMVEQIRTKNQLGKLGWFVGQMMRMGEKGRVEAPKADAILRELILG
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcccctggctgcgccaatcgactcgagcggcccgctctcttccttgttgccaa
tgtccccggccctatagctctcgactgcccacccttacgagcccatctagttcggttcgg
cgtttacaaacgtcagcttcagagtcgcaggaccgtgtaccactccggaagcagctcaaa
caaaatgcgaaggccttaaaagccgagaagcgtcagagaagggagagcgaggaggcttcg
cgacaaaaatgggagctcactgtcggcattgagattcatgcgcaactgaataccgagacc
aaactattttcacgtgcttcgacatcatccaccgacctacccaattcaaacgttgctctc
tttgacctggctttcccaggtagccagccggaattccaagttccaacactgctacctgcc
ctccgcgccgcactcgctctgaactgtgatatccagcccgtgagccgattcgatcggaaa
cattacttctatcaggaccagccagcgggatatcagattacacaatactatgaacctttt
gcgagaaacggctatgtggatttgttcggctacgatgggatcgcgccggaagatggcgat
cacgttcgcatcggtatcaagcaggtacagctagaacaggacacggccaaatcacaggag
taccatccctccacgcagcttcttgatttcaaccgcgtatcccaccccctagtcgaaatc
attacgatgccccagatccatacacccgcgacagctgcagcgtgcgtccggaagattcag
gcaatccttcaatcctgtagcgcagtcaccaccggtatggaattgggaggactccgagcc
gatgtgaatgtctcgatccgtcagcggggcgataccgagggtgtgcatcagtatggcggg
atcggtggcctcggccagcgcacggagatcaagaacttgagcagcttcaaggctgtagag
gatgccatcattgcagaaaagaaccgccagattgctgtgctagaaagtggtggggtcgtg
gagggtgagacccgtggctggacgattgggagcacggaaacacggagacttcgaggcaag
gagggcgaagtagactaccggtatatgccagatccggatctaccaccgctacttatcgga
gctgaccttgtgtcggagctggccaacacgttaccgacttcctcggatgagctaattggg
ctgttgacgggcaaagagtacggcctctcgattgaagacgccaagccgctggttgagcta
gaggatggagctcggctggagtactaccaggacgtggtggatatcctgcgcgatctgcag
caagaccaggatcctaagagccgtgggggtctggcacgcgttgccggtaattgggttctc
cacgagcttgggggccttttgactaaagcggacctgccttgggatgcagaacgagtctcg
gcactatcgctggctcaaattatagatcacgtccagcgaaagcagatcaccggtcctacc
gccaagcaggtgctagccatggtattcgacggagacactcgggcgattcctcagttactg
gaagaggagaacctacttctccggcctctctccagagaggaatacgttgcgttggctgag
gcagcaatcagccagaacccgcagatggtcgagcagatccggactaaaaaccagttaggg
aaactaggctggtttgtcggacagatgatgcgcatgggtgaaaagggccgagtagaagcg
cccaaggccgatgcgatcctccgggaactgattctggggtag

DBGET integrated database retrieval system