KEGG   Aspergillus oryzae: AO090003001009
Entry
AO090003001009    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K01771  1-phosphatidylinositol phosphodiesterase [EC:4.6.1.13]
Organism
aor  Aspergillus oryzae
Pathway
aor00562  Inositol phosphate metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AO090003001009
Enzymes [BR:aor01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.13  phosphatidylinositol diacylglycerol-lyase
     AO090003001009
SSDB
Motif
Pfam: PI-PLC-X
Other DBs
NCBI-GeneID: 5992102
NCBI-ProteinID: XP_023090184
Position
2
AA seq 505 aa
MFSPRQAFSLQLKPMGCYPGPWPKRSRTTMVAEHLTLRNLTSTPITLKRIERFHPHHGHN
IQHMARNFTRVFTNVTRTRAPVAAITDDNEPFVHEDLDIHIEPFQTIHTELRTFIDSDKE
RVRWFFEVEGERHQVQTPVPTSESATMKALCDEPRFKLTGIYVTPESHLSIYSSANLNAW
MGELKDDTLLSSLSIPGTHNSPTCHVAPPSVRCQAVSPREQLENGVRFFDIRVQPQYPED
ADKDELALVHSVFPISLTGSKYFRDLMREVNEFLDQNPSETLIISLKREGPGEHTDQQLS
RILSDHYARPDSRWYTNPKIPTLGEVRGKVVLIRRFDILDHLKDIHGGAGWGICASGWAD
NCSNATCPSGQLCIQDFYEVLETENIGEKIKYVQEHCFRAAETCYPFGVLPDHEATKAHP
FYINFLSASNFWKLGTWPEKIAGKLNPAAVDYLCRKHGEKDDCDWSTGILVTDWVGLDGD
WDLVRCIVGMNARLKLRQDRHEGDN
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgttctcccctagacaggcattttcacttcaattgaaacccatgggttgttatcctgga
ccgtggcctaaacgatcacgtaccacaatggtggccgaacacttgactcttcgcaatctc
acctccacgcccattaccctgaagcgcattgagcgctttcatccgcatcatggtcataat
atccaacatatggctagaaacttcaccagagtctttaccaatgtaacccgcacccgtgcg
ccggtggccgcgatcacggatgacaacgaaccctttgttcatgaggatttagatattcat
atcgaacctttccagacaattcacaccgagcttcgcacatttatagactcggataaagag
cgcgtgcgctggttcttcgaagtggagggagagaggcatcaagtccagactcctgtgccc
acctcggagtccgccactatgaaggcattgtgcgacgagcctcgattcaaactcactggt
atttatgtgacgcccgagtcccatctatcaatctactcctccgccaatctgaacgcgtgg
atgggcgagctgaaggacgacactttgctctcctctctctcgatcccaggcacccacaat
tctcctacctgccatgttgcgccaccctccgttcgctgccaagcagtcagcccacgggaa
cagctcgaaaacggtgtgcgattttttgacatccgtgtacagccccagtatccagaagat
gctgacaaggatgagcttgctttggtgcacagcgttttccccatctctttaacgggaagc
aaatatttccgtgacttgatgcgtgaagtaaatgaatttctcgaccagaatccgtcggag
accctgatcatctccctcaaacgagagggacctggcgagcacaccgaccaacagctcagc
cggattctcagcgaccactacgcacgtccagacagtcggtggtacacaaaccccaagatc
cccactctcggcgaagtgcgcggtaaggtcgttcttatccgtcgattcgacatcttggac
catctcaaggatatacatgggggcgcaggctggggaatctgtgcctcgggctgggccgac
aactgctccaacgcgacttgcccgagtggacaattatgcatccaggatttctatgaagtc
ttagagacagagaacattggagaaaagattaaatacgtgcaggagcattgcttccgagcc
gctgagacctgttatccgttcggcgtgcttcctgatcacgaagcaaccaaggcacatcca
ttctatatcaacttcttgagtgcgagcaatttctggaaacttggcacttggccggagaag
attgcaggtaagctgaacccggcggcagttgattatctctgccggaagcatggtgaaaag
gatgactgtgactggtccaccggtatccttgtcacggactgggttggcttggatggcgac
tgggatcttgtgcgatgcatcgtgggcatgaatgctcggttgaaactgaggcaagacaga
catgaaggagacaactaa

DBGET integrated database retrieval system