KEGG   Aspergillus oryzae: AO090003001064
Entry
AO090003001064    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; vacuolar protein sorting-associated protein
  KO
K19525  vacuolar protein sorting-associated protein 13A/C
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aor04131]
    AO090003001064
Membrane trafficking [BR:aor04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    AO090003001064
SSDB
Motif
Pfam: SHR-BD VPS13_mid_rpt VPS13 VPS13_C Chorein_N ATG_C
Other DBs
NCBI-GeneID: 5992152
NCBI-ProteinID: XP_001820168
UniProt: Q2UJU9
Position
2
AA seq 3170 aa
MLEGVVANLLNRFLGIYVKNFDAKQLNIGIWSGDVKLRNLELRREALDQLHLPLNVVEGH
LGELTLSIPWSNLRGKPVKVDIEDVFLLAAPKEDADYDPKEEARRAHALKMDKIESAELI
KERNAEGMSQEEQRRNQSFTQSLVTAVVDNLQISIKNVHFRYEDSIASPGHPFAVGFTLK
ELSAVSTDSEWNPTFIQSTSSTTHKLAVLGALSVYWNTDAELLGTGRGSDVGAKAQGINH
AELMERLKSGIDNEGNNQFMLRPVSGRAGLELDKSGEHDRAAIKARLLFDELSFVLDDDQ
YRDALMLVDLFHYFIRHQEYKKFQPKCRPKEDPRAWFKFAGNAVLSKIHERNRRWTWDYI
KERRDDRIAYIDLFKKQKREGTLSGPDADEFDRLQRKLSYEDIRFWRSLARNQLRKENVG
VKKPARQQTWSEWFWGAPKEESEEEAMTEEQRQELYNAIDWDEKKAITESVDEPREWVKL
QVNSSLRAGSFTLKRDPHGKANEIMKLVFDNFRAKALQRPDSFFIDVNLGGLRVYDGTTE
GTLFPQIVKVKDTLPVPKNRLSQISGNEELDSEGVADGIEDEDSLFHLQLEKNPLESDAD
SVVKVKLKSIEVIYNPRFLVEVVKFFEPPERHMESIGALMDTAGATVKGIRQQTRAGLEF
ALQEHKKVDAQFDIHAPLIIVPESITQESSLCLILDAGHISVNSELVDRQTMRDLQSKQK
RQYDEGDYKELEHLLYDRFLLKLDSTQVLIGPGIDITKSQLSSDVSSNNLHIIDRINVDF
VLEMCIVPKVTELTRTRISGHLPELHASMSDTKYKGLMKLIDIAIPRFDEGSQESIVSGK
GPEESSIPGTRARSSSFQPSVMRELPAVDEDSDEDSDDENMSKSVEGPTNLHRRDFEFKF
TVGRLRGSLFRSDPNDQLHDHLLVELVAEGFALDYYMRPFDMVAEIVLKSLSVDDYIEEN
PAPEFKRIVSSKGFDADEDKDLFHLKFVRVKPESPEFQSTYEGIAMNLDVSVSTINLVVT
RKTLLTLLDFILLTFTNPEQPSNQDLQSGQTIQNTSTTDQESQQAGKIRIKADLKSIALI
LNNDGVRLATLSLNTADIGIFLVGRSMLIQSRIGSLTLIDDVNTGAPESSDLRRLLTIEG
DNFADFKYETFDPDSANYPGYDSEVFLRSGSMKINFLEEPYRKIINFLVKFGKMQAIFNA
ARQAAANQANQLQENASRMRFDVVVMTPILVFPGVVKEDRPRDTVTAHLGEIYAKNEFVS
LEDEKDSPAVNVISTGIRNIRLTSKFHFEGGAVEELEMIQKVNLDFSICYLEHQPGNSRP
DMEVEGSMSPINLRISQKQLKFLLALSKTVPGAFAPDTEQQELEAMQALPSSVTEPTKEA
DSRAIQSRNDQDNLLQGAKTDETWVRLDMVFKVDGVGLELILSNDDEPVGRLEDSSLSKF
SLNDTKVKLRMLTDGSLESELLIHSLSIRDSRNKDTNKFRKIMSLINNDVQQQFMASVSM
SPGPAKHLIAMLTIDSPRIIVALDYLSALQSFANSAFATEESVEEEESDDTPEGSEPRSS
TADDTDESVITPSSGNTAAPPAGQMTVSFRLNLVDAQVIMIANPAITHTEAIVLGTKQLL
FSHQNVSALQISKVGMFLCRMDKFETSRLRILDDFTLEMSMDSRPQEKGSALISINVHLE
PLVLRLSLRDILMAIQIVNKASEMRAQKPNEGETGEVKRISDGKGTSAKSARRKSVGRPT
STALAPRSHRNSTGVIDTTEQELISHRSAILKKEEMNAQIDGVRVILIGDLHDLPLLDWS
VKKFTVDVRDWSSTLKADTSFDTFLNVYNFSKSAWEPLIEPWQLGFHMAKEVNPDVLSID
AYSHKTMELTLTSATIALASKSFQFLSTDEDVLSKPRGADAPYRIRNHTGFDLHVWADVN
ADEEGPAAKLADGEEYPWRFEDSTAMRETLAPEGHAGLVGIKLEGSGFESVSRIPVVREG
EILYNLKPKKDGILHRLLVEVKLGTDNVKYVTIRSPLVVENNTQIPVELGVFDPRDGHLL
KIEKILPGDSRPAPVGAAYMHSLLIRPDQGFGYEWSNEQLHWKDLMRRPTRTIKCISEGG
QQAPPFYFQMNATFNSRDPLTSTYPYMRVRIFAPVEIQNLLPYDFKYRIYDKNTRKDWTN
FLRKGGVSPVHVVELSHLLLLSIDLEDTVFKQSDFAIINGNAQDFRREHVLPLKDERGIQ
LRLKLHYFNVPDSGGAFKVSIYSPYLVLNKTGLSMEIQSKGFLQSARSAAGQGLRADPRH
GGRTLPYMYSYPSEDQKNRSILRIGDSAWSKPQSFEAIGSTFEVVLPDRHGRSEFHSGVT
VAEGEGKYKMTKVVTIAPRFVLKNKLNEDILVREPGSSNVLDIKSGDLVPLHFLRQVAEK
QLCLCFPGVNNQWSSPFNIADIGTVHVKLAKANQRQKLIKVDVIMENATLFLHFNLETRN
WPYSMRNESDMEFIFYQANPNVEDYEDDRTNGWRPIRYRLPPRSIMPYAWDYPATKNKSL
VLTCNGKERHIKLAEIGNLIPMRIPPTQYGEHQKIVDINIVADGPTQTLVSSNFKASKSM
YRQQRGQTSQSSLSTGFEVKELDSDVNFKAQLRLGGIGISLINQNMRELLYLTFREIDIK
YRESMVYQTLNTTIKWIQFDNQLYGGIFPILLYPSVVPKTGKEMEAHPIFHAMITRVKDD
SYGVLYIKYATVLLQQMTLELDEDFVFAMLDFVKVPGASWSEEQEGKLCDEDLRIPEPQS
EGAGQDVYFELLHLQPMQLDISFMRTERVNAEDTMQPSNPLMFFVNVMTMSMGNINDAPV
RLNALMLENARVSLGVLVGNVQRHYTQEFLRQVHVVLGSADFLGNPVGLFNNVSSGVAAI
FYEPYQGLVMTDRPQELGYGIAKGATSFVKKSVFGFSDSMAKLTGSMSKGLAAATLDKEF
QDKRRMSKSRNRPKHALYGITAGGNAFATSLASGIGGLARHPLQGAEKEGIQGFFKGVGK
GVLGLATKPAIGAFDLASNLAEGVRNTTTVFDAEGLDRVRLTRFIATDGIVRPYSQREAL
GQFWLKTADDGKYFSEDYIAHLELPGRDMLVMLTYDRIMLVRTKKLQTEWDIRLTDIQTI
SKERTGMSITLKGGANGPFIPVQDESSRNWLYRQIAIAVNAFNEKYNSKG
NT seq 9513 nt   +upstreamnt  +downstreamnt
atgttggaaggggtggtggccaacttactcaatcgcttcttgggtatctacgttaaaaac
ttcgatgccaaacagctcaacattggtatatggtccggtgatgtaaagcttcgtaaccta
gaacttcggcgcgaagcgctcgaccaactacacctccccctcaatgtcgtcgaaggccac
ctcggtgaactcaccttgtccatcccctggtcgaatttgaggggaaagcctgtcaaggtc
gatatcgaagatgtgtttctcctggcggccccgaaggaagatgccgactatgatcccaaa
gaagaggcaagaagagcgcatgctctcaaaatggacaagattgagagtgcagagcttatt
aaagagcgaaacgcggagggcatgagccaggaagagcaacgacgaaatcaaagcttcacc
caaagcctggttaccgcggtagttgataatcttcagatctcaatcaagaatgtccacttc
cgctacgaggactcgatcgcttcgccgggccacccattcgccgttgggttcacactgaaa
gagctaagcgcggtcagcactgattctgaatggaacccgaccttcatacagtctacctca
agcacaacacacaaactggctgtcctaggcgctctgtccgtctactggaacacagatgca
gaactattaggtacgggtcgaggttccgacgtgggcgcaaaagcgcagggcataaatcat
gcggaattgatggagaggctgaagtctggtattgataacgagggaaataaccaattcatg
ctccgccctgttagcggtcgtgctggattggaattagacaaatcaggagagcatgatcga
gcggccatcaaggcacgtttgttgtttgatgagctgagcttcgttctagatgatgaccaa
taccgagatgcattgatgctcgtggatctcttccactacttcattcgtcatcaagagtat
aagaaattccagccgaagtgccgcccgaaagaggacccccgggcttggtttaagtttgct
ggaaacgccgtcctcagcaaaattcatgaacgcaataggcgctggacctgggactatatc
aaagaacgacgggatgatcgcatagcctatatcgatttattcaaaaagcagaaacgggaa
ggaacattatcagggccagacgcggatgagttcgaccgactgcagcggaaacttagctat
gaagatatacgattctggagatcgctggcaaggaaccagttgcgcaaagaaaacgtgggt
gttaagaagcctgcacgacaacaaacttggtcagaatggttctggggtgctccaaaggag
gaatccgaggaggaagcaatgaccgaagaacagagacaggagctctacaatgccatcgac
tgggatgaaaagaaggctatcacggaaagcgttgatgagcctagggagtgggtaaaactc
caagtcaactccagccttagagccggcagtttcacattgaagcgcgaccctcatggaaag
gcaaacgaaattatgaagctagtatttgacaatttcagagcaaaggccttacagcgccct
gactctttcttcatagatgtgaatctcggaggacttagagtatacgacgggacaacagag
gggacgctctttcctcagattgtcaaagttaaagatactctcccggtgccaaagaaccgt
ttatcacagatatctgggaacgaagagctagattctgaaggggtggctgatggtatagag
gatgaagatagtctgttccatctccagctcgagaagaatcctcttgaaagtgacgcggac
tcggtagtcaaagtcaagttgaagagtatcgaagtcatctataaccccagattccttgtg
gaggtcgtcaagtttttcgaacccccggagcggcatatggagtcgattggcgctcttatg
gatactgcaggagctacagtaaagggaattcgacagcaaactcgggctggcttagaattc
gctctgcaagagcataagaaggtcgatgcgcagttcgatatacatgcacccctcataatc
gtcccggagagtataactcaagagagttcactttgcttgattctcgatgcaggccacatc
agtgtcaacagtgaactggttgacaggcagaccatgagagacctccagtcgaagcagaaa
cgccaatatgatgagggtgactataaggaacttgagcatttgttgtatgacaggttcttg
ctgaaactggactccacccaagtccttataggccctggaattgacatcaccaagtcacaa
cttagctctgatgtctcctcgaataatttgcatattatcgaccgcataaatgtagatttc
gtacttgagatgtgcattgttccgaaggtcactgagcttacaagaactcgaatttccggg
catcttccagaactgcacgcgtctatgtccgataccaagtataagggcctgatgaaactg
atcgatattgctatcccccgctttgatgagggcagccaggaatccatcgtctctgggaaa
ggtccagaagagtcgtctattcctggaacaagagcaagatcttcatctttccagccgtca
gttatgagagaactccctgccgtcgatgaagattctgacgaggactccgacgatgagaac
atgagcaagagtgttgagggtccgacgaatctccatcgtcgtgattttgaattcaagttt
accgttggtcgccttcgtgggtcattgtttcgctccgacccgaacgaccagctccatgat
cacctgctagtcgaattggttgctgaagggtttgcgttggactactatatgcgcccgttt
gatatggttgcagaaatagttctgaagtctttaagtgtggatgactatattgaggagaat
cctgcgcctgaattcaaacgaatagtatcctccaaaggcttcgacgcagatgaagataag
gacctgtttcatctcaagtttgttcgtgtgaaacctgaatccccggaatttcagtccacc
tatgaaggaatagcaatgaaccttgatgtttccgtctcaactatcaatcttgttgtgacc
aggaaaacgctcctcacacttctggactttatccttctcacgttcaccaatccagaacag
ccaagcaaccaagaccttcagtcaggccagaccatccagaacacaagcacaactgatcaa
gaatcccagcaggctgggaaaatccgcatcaaagccgacttaaagagtatcgcgctcatt
ttgaacaatgatggtgtaaggctcgctaccctcagcctcaacactgccgatattggcata
ttcctggtgggccgatcgatgcttatccaatcccgtattggaagcttgaccttgatagac
gatgttaacaccggtgctccagagagttctgatcttcgaagactcttaacgatcgaggga
gataactttgccgacttcaagtatgagacgtttgacccggacagtgcgaactaccctgga
tatgactcggaagttttcttaaggtcaggttcaatgaagatcaacttcctagaggaaccg
taccgtaagatcatcaacttcttggtcaagtttggcaagatgcaagcgatcttcaatgct
gcccgccaagctgcggcgaatcaagcaaaccagcttcaagaaaatgcgtccagaatgagg
ttcgacgtcgtcgtcatgactccgattttggtattccctggagtcgtgaaggaagatcgc
ccccgtgatacggttacggcccatctcggtgaaatatacgccaagaacgaatttgtttcc
ctagaggatgagaaagacagccccgctgtcaatgtaatatctactgggattcgcaacatc
cgactgacatccaagtttcattttgagggaggtgcagttgaagagcttgagatgatacag
aaagtcaatctcgatttcagcatatgttatctggagcatcaaccaggaaattcgcggcct
gatatggaagtggagggatcaatgtctcccatcaatcttcggatatcgcagaaacagctt
aagtttttattggcgctgtctaaaacagtgcctggggcttttgcaccggatacggaacag
caggagcttgaagccatgcaagcgcttccatcttctgtgacggaaccaacaaaggaggca
gattccagagcaattcaaagcagaaatgaccaggataatctattacagggcgcaaagacg
gacgaaacatgggtccgacttgatatggttttcaaggtagatggtgttgggttggagctc
atcctctcgaatgacgacgagccggtcggccgtctggaagattcgagcctttcgaagttc
tccctcaatgacacaaaagtaaaattgcgcatgttgacggatggttctctggagtcggaa
ctcctgatccactctctctcgatccgtgatagtcgcaataaggacacgaacaagttcagg
aaaataatgtccctaatcaacaatgatgtccagcagcaattcatggccagcgtttcaatg
tctcctgggccagccaagcacctgatagcgatgctgaccattgatagcccgcgaataata
gttgctttggactatttgtccgctttgcagtcatttgccaattccgcgtttgcgacggaa
gagtcagtggaagaagaggaaagcgacgacacaccggaggggtcagaacccagatcgagt
accgcagatgatactgatgagtctgtcattacgccctccagtgggaacactgcagctcct
cctgctgggcagatgacggtgtcgttccgattgaatctcgttgatgcccaggtgatcatg
atcgcaaatcccgctataactcatactgaggcgattgtgctgggaacgaagcaattactc
ttctctcatcagaatgtttcagccctacaaatatccaaggttggtatgttcttgtgccgt
atggacaagtttgaaaccagtaggcttcgcatattagatgacttcactttggaaatgtcc
atggacagccgcccacaggaaaaaggctctgctttgatctctattaatgttcatcttgag
ccccttgtcctccgcctttctctccgtgacattttgatggccattcaaattgtcaacaag
gcatctgagatgagagctcagaaacccaatgaaggtgaaaccggcgaggtgaagagaata
tctgatggaaaaggaactagtgcgaagtccgcaagaaggaagtcggtcggcaggccgacc
tcgactgcacttgcgccaaggtcacatcgcaactccaccggggtgattgatacgacagaa
caagaacttatatcgcatcgctcagccatcctcaagaaagaagaaatgaatgcccagatt
gatggtgtaagggtaatccttataggagacctacacgacctgccattactcgactggagt
gtcaagaagttcactgtggacgtccgtgactggtcatcgacgctgaaagctgacactagc
ttcgataccttccttaacgtgtataacttctctaagtcagcctgggaaccgcttatagaa
ccatggcagttaggcttccatatggcaaaggaggtcaatcctgatgtgctttcgatagac
gcctattctcataagacgatggagctcaccctcacctctgccacaatcgcactggcgtca
aagtcgttccaattcctctctactgatgaagatgttctctcaaagccacgaggagccgac
gccccataccgaatccgtaaccacacaggctttgaccttcacgtttgggctgatgttaat
gcagatgaagaaggaccagcggccaaattggctgatggtgaggaatatccttggaggttt
gaagactcgactgccatgcgtgaaacactcgcacccgaaggtcatgccggtcttgtcggt
atcaagcttgaaggaagtggctttgagagcgtgagccgtattcctgttgttcgggaaggg
gagattctgtacaatctgaagccaaagaaagatggcattcttcatcgacttcttgttgag
gttaagctgggcaccgacaacgttaaatacgtcactatccgctctcctctggttgtggag
aacaatacccagataccagtggaattaggtgttttcgatcctcgtgacggccatcttcta
aaaatagagaagatcctccctggggactcacggcctgcacctgtgggagctgcatacatg
cattctcttcttattcgacctgatcaaggctttgggtatgagtggtcgaacgagcaacta
cattggaaagaccttatgcggcgaccaactcggacaatcaaatgcataagtgagggtgga
cagcaagcgccgccattctacttccaaatgaatgctactttcaattcacgggatcctctg
acgagcacatatccgtacatgcgcgtccggatatttgcccctgtggagatacaaaatctt
ctcccgtacgatttcaaataccgcatctatgataagaatacaaggaaggactggactaat
ttcttgcggaaagggggcgtgagcccagtccatgtcgtagaactatcccacttactactt
ctcagcatcgacttggaggatactgtcttcaaacaaagtgattttgctataatcaatggc
aacgcacaagacttcagaagagagcacgtgttgcctttgaaagatgaaagaggcatccaa
ctgagactgaagcttcactatttcaatgtgcctgatagtggaggcgcattcaaagtatcg
atctacagtccatatctcgtcctaaacaagacaggcctctcgatggaaatacaaagcaaa
ggcttcttacaatcggctcgatcagcagctggacaagggctgagggctgatccaaggcac
ggtggccgaacactcccttacatgtactcctatccaagcgaggatcagaagaaccgatcc
atactaaggataggcgattctgcctggagcaagcctcagagtttcgaagccattgggagt
acattcgaagttgttcttccagatagacatggtagatctgagttccattccggcgtgact
gttgctgagggtgaaggcaaatacaaaatgaccaaggttgtcaccattgcgcctcgtttc
gttttgaagaacaagcttaatgaggatattttggttcgagaaccgggttcttccaatgtt
cttgatatcaagagcggtgatcttgtacctctgcatttcttgcgccaggttgccgagaaa
caactttgcctgtgcttccccggagtcaacaaccaatggtcctcacctttcaacatcgca
gacattggtacagtgcatgtcaagcttgccaaggcaaatcaacgccagaaactcatcaaa
gtggacgttatcatggaaaatgcaactctcttcctgcatttcaaccttgaaacacgaaat
tggccgtattccatgcggaacgagagcgacatggaattcatattctatcaagccaatcca
aacgtggaagattacgaggacgacaggacaaatggctggcggcccatccgctaccgtctt
ccaccacgaagtatcatgccatatgcttgggattatccagctacgaagaacaaatccctc
gttctgacatgtaatggcaaagaaaggcatatcaagcttgccgagattggtaatctgata
ccaatgagaataccgccaacgcaatatggtgaacaccaaaagattgtcgacatcaatatt
gtggccgacggccccactcagactctagtctcatcgaatttcaaggcatcgaagagcatg
tacagacagcaaagaggacagacctctcagagcagtttgagcaccgggttcgaagttaag
gagttggattcggacgttaacttcaaagctcaactccgccttggtggtattggcatctct
ttgatcaaccagaacatgagggagctgttgtacttgaccttccgcgagattgatattaag
tacagagagtccatggtttatcaaacgctgaataccacaatcaagtggatccagtttgac
aatcagctttatggaggtattttccccatcttgttgtaccccagcgttgttccaaagacc
ggaaaggaaatggaggcacatccaattttccacgccatgattacacgcgtgaaggatgac
tcctatggcgtactctacattaagtatgccaccgtgcttctgcaacaaatgacactagag
cttgatgaggactttgtgttcgcaatgctggacttcgtgaaagtccctggtgcctcgtgg
tccgaagaacaggaaggaaagctttgtgatgaagatctaaggattccagagcctcagagt
gaaggtgctgggcaggatgtctacttcgaacttcttcatctgcaacccatgcaacttgac
atctctttcatgcggacagagcgagtgaacgccgaggacactatgcaaccatcgaatcct
ctaatgttctttgttaatgtcatgaccatgtcgatgggcaacatcaatgatgcacctgtt
cgtcttaacgcactaatgctggagaatgctcgtgtgtcgcttggggttcttgttggcaac
gttcagagacactatactcaggagttcctccggcaagtgcatgttgtccttggatctgca
gatttccttggaaaccctgttggcttgttcaataacgtcagctccggcgttgccgcaatc
ttctatgagccataccaaggactcgttatgactgataggcctcaagaacttggttacggc
attgccaagggggctacaagttttgttaagaagtccgttttcggattctccgacagcatg
gccaaacttaccggaagcatgtctaaaggtcttgctgctgccactttggacaaggagttc
caggacaagcggcggatgtctaaatctcgaaaccggccgaaacatgcactgtatggtatc
acggctggcggtaatgcattcgcaaccagcctagcaagcggtatcgggggactcgcacgt
cacccactacagggtgctgaaaaggagggtattcaagggttcttcaagggtgttggaaag
ggtgtcttaggtcttgctacgaagccggccattggcgcctttgatcttgcttcaaatctt
gctgaaggtgtacggaacactactactgtctttgatgcagagggcctagaccgtgttcgt
ctcacgcgcttcattgcaacagacggcattgtgcgaccatattcacagcgggaggcactg
ggtcagttctggctcaaaacagcggacgacggcaaatacttcagcgaggattatatcgcg
catctagaacttcccggcagagacatgctggtcatgttgacatacgaccgtataatgctt
gtgcgcaccaagaagctccagactgagtgggatatacgcttgaccgacatccaaacaata
tctaaagagcgcactggcatgagtattacactcaaggggggtgctaatggcccatttatc
ccggtgcaggatgaaagttcgaggaattggctgtaccgccagattgccattgctgtgaat
gcattcaacgagaagtacaacagcaagggttaa

DBGET integrated database retrieval system