KEGG   Aspergillus oryzae: AO090003001076
Entry
AO090003001076    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: DUF4129 NICE-3
Other DBs
NCBI-GeneID: 5992159
NCBI-ProteinID: XP_023090205
Position
2
AA seq 409 aa
MAWNFYRILNYTIFIVLSVILFCLIVLTPADAIYQCYVTSRLTNIFIISGGYIVTFILAA
LIYATRIYTNRSALAGIPKAWIPIEKEDVGKSVRRLVVEGLARSAIVAYQARPRDTAADG
DTFADYPMLLIDCDRPPWGSVEHPGWSSPASPDLPDLPYRTVIQELPNLIEAKAVSLAPP
DPFLTATRSFDPSSPGAEQSIPDTRVVDILRRPVSMGLREYLQHLASLNVIQPPEIGAEF
IALYERARFSSRELHETEFRDLMHIFAGLLRGMKSLDTHIMDDIYAEGSRGDSESVIGPS
DEEGETDTMDFHDDSEAFSRGRSNSLQPSNASTWEGRSTYAASGNQSYRSPVWSRNVDPH
RLATPRTPSMRSLRRVQSNASGSSGGSVIRLVDTHGPTDLPYAINFNRT
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggcctggaatttctatcgcatcctcaactacactatctttatcgttctctccgtcatc
ctcttctgtcttatagttctgaccccggccgacgcgatctaccagtgctacgtaacctcg
cgactcacgaacatttttattatcagtggtggctacatcgtgacttttatattagcggcg
ctgatatatgcaacgcggatctataccaatcgcagtgccttagctggaatccccaaagca
tggatcccaatcgagaaggaagatgtcggaaagagtgtgcgacggctggtggttgaaggt
cttgctcgcagcgctattgttgcttatcaagctaggccacgggacacagctgcagatgga
gatacctttgccgactaccccatgctcttgatagactgcgaccgcccgccgtggggctct
gtcgaacaccccggatggtcttctcctgcatcccccgatttgcccgacctgccgtaccga
acggtcattcaggaacttccaaacctgatcgaagctaaagcggtctcgctcgctccccct
gacccctttttgacagcgacccgctcgtttgacccctcctctcctggcgccgaacaatca
atcccggacacacgagtggtggatatcttacggcgaccggtgtcgatgggtctgagggaa
tatttgcaacatcttgctagcctgaacgtcattcagccacccgagattggagcagaattc
atcgcactatatgaacgcgcgcgcttctcgtcgcgcgagcttcacgaaaccgagtttcgg
gatctgatgcacatatttgccgggcttctaagagggatgaagtcgcttgatacgcacatt
atggatgatatatatgctgaaggctctcgcggcgatagcgagtctgtcattggaccttca
gacgaggaaggggaaactgatacgatggatttccacgatgacagcgaggcgttctctcga
ggccggagcaacagtttacaaccttcgaatgcatcgacatgggagggtcgctccacttac
gctgcatcgggaaatcagagttataggtctcctgtttggtccagaaacgttgacccgcat
cggctggcgacgccccgaacgccatcgatgcgatcgcttaggcgggtacagtctaatgcg
tcgggcagttctggaggaagtgttattcgtttggtagatacccatgggccaactgatttg
ccctacgcgattaattttaatagaacgtga

DBGET integrated database retrieval system