KEGG   Aspergillus oryzae: AO090003001310
Entry
AO090003001310    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ankyrin repeat
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5 PilZ_2
Other DBs
NCBI-GeneID: 5992357
NCBI-ProteinID: XP_023090303
Position
2
AA seq 227 aa
MSEDNRLIAIYLQDSFLTMQRFERKHDVSAGGRDLSGRTPLSRAAECGHEAIVSLLLSRN
DVDPDYEDTNGRTPLSYAAVSGHLTIAKLLLQSGRVYAESEDEYGRTPLSRAAEGGHKEL
LEMLLESGAKLESKDRDHRTPLSWAAAENDHGAVVALLLELGAAIESKDREERTPLSWAA
MKGRGAVVTLLLERGANIESEDKHSRTPLSWAARKEQEATFARGLES
NT seq 684 nt   +upstreamnt  +downstreamnt
atgagcgaggataaccggctgattgcaatatatttgcaagattcattcctgacaatgcaa
cgatttgaacgaaaacatgatgtcagtgctggtggaagggacctcagcggccgcacgccg
ctctcgcgcgcagcagaatgtggacatgaagcaatcgtgagcctgttactatctcggaac
gatgttgatcctgattatgaggatacaaatgggcgaacgcccctttcatacgctgcagta
tcgggtcacctgacaatcgccaaattattgcttcagtctggtagagtctatgctgaatcg
gaggatgagtacggtcgaactcctctttcacgtgctgcagagggcgggcacaaagaattg
cttgaaatgttgcttgaaagtggtgctaaactggaatctaaggatagagatcaccgaaca
ccattatcttgggctgctgcggagaacgaccatggcgcagtagtagcacttctacttgaa
ctgggagctgcgatagaatcaaaagatcgagaggagcgtacaccactatcctgggctgcg
atgaaagggcggggagcagtagtaacgcttctacttgagaggggagctaatatagagtcc
gaagacaagcattcccgtactccactgtcatgggctgcaaggaaagagcaagaggccaca
ttcgccaggggattagaatcttaa

DBGET integrated database retrieval system