KEGG   Aspergillus oryzae: AO090005000418
Entry
AO090005000418    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; DNA or RNA helicases of superfamily II
  KO
K17677  ATP-dependent helicase IRC3 [EC:3.6.4.-]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aor03029]
    AO090005000418
Enzymes [BR:aor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AO090005000418
Mitochondrial biogenesis [BR:aor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    AO090005000418
SSDB
Motif
Pfam: ResIII Helicase_C DEAD SWI2_SNF2 DUF2075 UvrD-helicase
Other DBs
NCBI-GeneID: 5989431
NCBI-ProteinID: XP_001817486
UniProt: Q2USI1
Position
1
AA seq 662 aa
MECVRGKLGRVPVSRLLLRPHRTSWRPGPSQHHFRLSSSVPAARESPAIVLRDYQEECIK
SVLDNLDQGHKRLGVSLATGAGKTVIFTQLIGRIPPRNEKDNKTLILVHRRELVEQAARH
CRLAYPDRTVEIEMGTSKASPAADIVIASIRSLTNGDRIAKFDPKQFKLVLVDEAHHIVA
PSYREVLKYFGLNETSHDSPVLVGVSATLSRADGLKLGAAIDHIVYHKDYMDMIDEEWLA
NAVFTTVQSEANLSRVKKDSFGDFAVGSLSKAVNTDRTNDITVHAWLANAQERKSTLVFC
VDVEHTKQLTETFRAAGVDARYLTGKTPKEVRDDQLQRFRDQEYPVLLNCGLFTEGTDIP
NIDCVLLARPTRSRNLLIQMIGRGLRLHPGKKDCHIIDMVATLETGVLSTPTLFGLHPDE
VLANANGKDLKHKESDPSPSTDLDNSPGPDTLDDINLTFTKYDTIYDLIMDMKSEKYIRS
SSRNAWVRIDENKYILSDSTGWITIDKSTDEHLKSPKDDPQRPLWTVQYVQVYKNPTTEK
NTYTRPRLIATGPDLESAVHAADTFAASEFEDLYISALQPWRRRPATWAQLNFLNKAKIR
RDALRPEHLTKGQAADLITKLKHGGKKRFEKQAGRRRKEDEKAKELEAFRARERVRVGPV
LM
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggagtgtgttcgtgggaaattgggacgggtccccgtttcgcgtctcttattgagaccc
cataggacttcctggaggcctggcccttctcaacatcacttccgcctcagctcctctgtc
cccgccgcgcgcgagtcgcccgctatagtccttcgggattaccaggaagaatgcatcaaa
tcggtgcttgataatttggatcagggccacaaacgccttggagtttcacttgcgacgggt
gctgggaaaacggtgatctttacacagctcatcggccgcatacctccgcgaaatgaaaaa
gacaacaaaaccttgattctcgtccatcggcgcgaactagtcgaacaggccgcccggcat
tgtcgtcttgcctacccggatcgaaccgttgagattgaaatgggcaccagcaaagcctca
ccggcagcagacatcgtcatcgcttctattcggagtttgacaaatggagatcgtatagcc
aaattcgacccgaaacagttcaaacttgtcctcgtggatgaagcccaccatatagtcgca
ccgtcctaccgagaagtgctcaaatactttgggttgaacgagacatcgcacgactcgccg
gtgctagtcggcgtgtcggcgacgctatcgcgagccgatggcttgaaactaggcgcggcc
atcgatcacattgtctaccataaagactacatggacatgattgacgaggaatggctagcc
aacgcagtcttcaccaccgtacaatccgaagccaacctgtcccgcgtgaagaaggacagt
ttcggcgacttcgccgtcggctcgctctcaaaagcagtgaacaccgacaggacgaatgac
atcacagtgcacgcctggttagcaaatgcccaagagcgcaaatcaaccttagtcttctgc
gtcgatgttgaacacacaaagcagctcaccgagacctttcgcgctgccggcgttgacgcc
cgctatctcacgggcaagacaccgaaggaagtccgcgacgaccagctccaacgcttcaga
gaccaggaataccccgttctcctgaactgcggcctcttcacagaaggcactgacatcccc
aacatcgactgtgtcttactcgcacgaccaacccgctcccgcaacctcctcatccaaatg
atcggccgcggactacgtctccacccaggcaaaaaggactgccacatcatcgacatggtc
gcgaccctggaaaccggcgtcctctccacacccaccctcttcggcctccacccagacgaa
gtcctagccaacgccaacggcaaagacctcaagcacaaagaaagtgacccatcaccatcc
acagatctagacaactccccaggcccagacacactagacgacataaacctaaccttcacc
aagtacgacacaatatacgacctaatcatggacatgaaatccgagaaatacatccgctca
tcaagccgcaacgcctgggtccgcatcgacgaaaacaaatacatcctctccgactcaacc
ggctggatcacaattgataaatcaaccgacgaacacctcaaatcacccaaagatgacccc
caaagaccgctctggacagtccaatacgtccaagtatacaaaaaccccaccacagagaag
aacacctacacccggccccggttaatagccacgggcccggacctcgaatccgccgtccat
gcagccgacaccttcgcagcttccgagtttgaagatctgtatatctccgctctacaaccc
tggcgtcggcggcctgccacctgggcgcagttgaacttcctcaataaggctaaaatacgg
agggatgcactccggccggaacatttaactaagggtcaggcggcggatttaataacgaag
ctgaagcacggtggaaagaaaaggttcgagaagcaggctggtcgaagacggaaagaagat
gagaaagctaaagaattagaagcgtttagagctagggagagagtacgggttgggcctgtt
ttaatgtga

DBGET integrated database retrieval system