KEGG   Aspergillus oryzae: AO090005000479Help
Entry
AO090005000479    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
aor  Aspergillus oryzae
Pathway
aor00071  Fatty acid degradation
aor00410  beta-Alanine metabolism
aor00592  alpha-Linolenic acid metabolism
aor00640  Propanoate metabolism
aor01040  Biosynthesis of unsaturated fatty acids
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01200  Carbon metabolism
aor01212  Fatty acid metabolism
aor04146  Peroxisome
Module
aor_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
aor_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AO090005000479
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AO090005000479
   00592 alpha-Linolenic acid metabolism
    AO090005000479
   01040 Biosynthesis of unsaturated fatty acids
    AO090005000479
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AO090005000479
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AO090005000479
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     AO090005000479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1 RAWUL
Motif
Other DBs
NCBI-GeneID: 5989484
NCBI-ProteinID: XP_001817539
UniProt: Q2USC8
Position
1
AA seq 694 aa AA seqDB search
MPSPPPAWVQALKPAGPQGSELLAQERAQSNVDVDKLAELLHTKKALDRQQQILSILESD
KVFDKSENYTLGRTEKIQRALAKAKRLQQLAVQHKWSQDDYYMANELLSEPTPYGLHASM
FLVTLREQTTPEQKKLFLEPASKYEIIGCYAQTELGHGSNVRGLETTATWNPDDKTFTIH
SPTLTASKWWIGSLGRTANHAVVMAQLFIGGKNYGPHPFVVQIRDLQTHQPLENIYVGDI
GPKFGYNTMDNGFLLFNKVKIPHVNMLARFSSVDKETNKYLRPASHSLLYGTMTWVRSNI
VLQAGSVLARGVTIATRYCAVRRQFQDRDGGKDAGENQVLNYKMVQIRLLPLLASMYALH
FTGRGMMRLYEENQKRMKGAVEAGQDKRGAGPEQLRAGADLLADLHATSCGLKALASTTA
GEGLEICRRACGGHGYSNYSGIGPWYADYLPTLTWEGDNYMLTQQVARYLLKSARAVLAG
KGTNNDTSQILQTYLSRREKGASFDILEEDKDIVAAFAWRTAHLTFEALKRRDVEKRSWN
SLLVDFWRLSTAHSQYLVVKNFYEAVTSPQLTSELDPETVTLMHKLFRLYSLHTLEREAG
EFFSSSAVTTRQISLAQSNAVMKLLDEIRPHAVRLVDAWKFPDWQLDSSLGRYDGEVYPD
LFRRASQNPVNDLVFDPYPWNENVLKNSAPKSKL
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgccttctcctcctcccgcctgggtccaggcgttgaagccggccggcccgcaaggctcc
gagctgctcgcccaggagcgcgcccagtccaacgtcgacgttgacaaattggccgaatta
ttacataccaagaaggcattggacaggcaacagcaaattctgtccatcctggagtcggac
aaggtgtttgataaatcagagaactacactttgggccggacagagaagattcaaagagcg
ttggccaaggcgaagcgtctgcagcaattggcagtgcaacacaagtggtctcaagatgac
tactacatggccaacgagctcttgtcggagccaactccctatggtctccacgccagtatg
ttcttggtcactttacgggaacagactacccctgagcaaaagaagctcttccttgaacca
gcttcgaaatacgagatcattggatgttacgcacagacggaattgggccatggttccaac
gtccgtggcttggaaacaacagccacttggaaccctgacgacaaaactttcacaatccac
tctcctaccctgactgcctcgaagtggtggatcggctctctgggtcgcactgccaaccat
gccgtggttatggcccagctgttcatcggaggcaagaactatggcccccacccgttcgtt
gtccagattcgtgatctgcaaacccaccagcctctggagaatatctacgtcggagacatc
ggtcctaagttcggctataacacgatggacaatggtttcctgctgttcaacaaggtcaag
attcctcacgtcaacatgctggcccgtttctccagcgtcgataaagagaccaacaagtat
ctgcgcccggcgtctcactcgctcttatacggtaccatgacctgggtccgctccaacatt
gtgctgcaggccggtagtgtcttggctcgcggcgtcaccatcgccacccgttattgcgct
gtccgtcggcagttccaggaccgcgatggcggtaaagacgctggagaaaaccaggtcctg
aactataagatggtccagatccgtctccttcctttgctcgcttccatgtatgctctgcac
tttaccggtcgcggtatgatgcggctctatgaggagaaccagaagcgaatgaagggcgcc
gttgaggctggtcaggacaagagaggcgcaggccctgagcagcttagggccggtgccgac
ctgctggcagatctccacgccacttcctgcggactgaaggcactcgctagtaccactgcc
ggagagggtctcgaaatttgtcgtcgggcttgtggtggccacggatacagcaattacagc
ggcattggaccgtggtatgcggactaccttcccacgctgacctgggagggtgacaactac
atgttgacacaacaggttgcaagatatctcttgaaatccgcccgtgccgtccttgccgga
aagggaaccaacaacgacacgtcccagattctgcagacatatctctctcgtcgggagaag
ggcgcttcttttgacatcctggaagaggacaaggacattgttgctgcctttgcctggcgt
accgcacatctcaccttcgaggccctgaagcgccgagacgttgagaagcggtcatggaac
agcctgctggtcgacttctggcgactgtcgaccgcgcactcgcagtacctcgtggtcaag
aacttctacgaggcggtcacttcgccccagctgacatccgagctggatcctgagactgtg
accctgatgcacaagctcttccgcctgtactctctgcacactctcgagcgtgaggccggt
gagttcttctcgtccagtgccgtcaccacccgccagatctcgctggcgcagtcgaacgct
gtgatgaagcttctggacgagatccggccccatgccgttcgtctcgtcgatgcctggaag
ttccctgactggcagctcgacagcagtctgggccgctacgatggtgaagtctacccggat
ctgttccgacgtgcttctcagaacccggtcaacgacctggtattcgatccctacccatgg
aatgagaacgtgctgaagaacagcgcacccaagagcaagctttaa

DBGET integrated database retrieval system