KEGG   Aspergillus oryzae: AO090005000823
Entry
AO090005000823    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; Fe2+/Zn2+ regulated transporter
  KO
K22685  DNA-dependent metalloprotease WSS1 [EC:3.4.24.-]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aor01002]
    AO090005000823
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aor03400]
    AO090005000823
Enzymes [BR:aor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     AO090005000823
Peptidases and inhibitors [BR:aor01002]
 Metallo peptidases
  Family M80
   AO090005000823
DNA repair and recombination proteins [BR:aor03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     AO090005000823
SSDB
Motif
Pfam: WLM zf-RanBP DUF45 Peptidase_M54 SprT-like
Other DBs
NCBI-GeneID: 5989784
NCBI-ProteinID: XP_001817839
UniProt: Q2URH8
Position
1
AA seq 413 aa
MREIDPLVFEYQHDRHRPRESEALTMLKKIASLVKPIMRRRTWKVGTLSEFYPHQQNLLG
LNINRGQKICLRLRYPYDERQFLPLEQVVDTMLHELCHIVHGPHNREFHALWNQLRDEYE
ELLMKGYTGEGFLSEGKRLGGRRIPLHEVRRQAKAAAEQRRALSAGSGQRLGGAPVLRGT
DMRRMIADAAQRRIDVTKGCASGAENSNELAEEASRNGFRTKAEEDDANEQAIMQAYIDL
IEEEERERYGPSYVPPSHENPAGPRSTLSPPPVPERTRPTMTPQPREPIDLTVDDSLFEA
SWTCPTCTLENPANFLCCDACTAERPRPSNRRSVSGPAKIQGSSGSQNKNKRRISYLDSQ
PTFKNRTNAVETLAALERNTAKRPLGWICQFCETFMEAEWWTCSNCGTVKASS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcgcgaaatagacccactagtttttgaatatcaacatgacaggcaccgacccagggaa
tctgaagccttaaccatgctcaaaaagatcgcatcgctggtcaaacctatcatgcgccgg
aggacctggaaagtagggacgctcagtgaattctacccacatcagcaaaacctccttggg
cttaatatcaacagaggacaaaaaatctgccttcggctgcggtacccttatgacgagcgt
cagtttctcccgcttgaacaagtcgtcgatacgatgctgcatgaactttgtcacatcgtg
catgggccgcataacagagagttccatgctctctggaaccagttacgcgatgagtatgaa
gagcttctcatgaagggctatactggggagggattcctttcagaaggaaaacgtctaggt
ggccgtaggataccccttcacgaagtccgaagacaagccaaagcggccgcagagcagaga
cgggcactgtccgctgggtcggggcaacgactagggggtgctcctgtattacggggaacg
gacatgcgccgaatgatcgcggatgctgcacaaagaaggatagatgtaacgaagggctgt
gcttcgggggctgagaacagcaacgaactcgcggaagaggcgtccaggaacggcttccgg
acgaaggccgaggaagacgacgcaaatgaacaagcaatcatgcaggcttacattgatttg
atcgaggaagaagagagggagagatacggcccttcttatgtccccccaagccatgagaat
ccggccggcccacgttcaactttatctcctccacctgttcccgagaggactagacctaca
atgacaccacagcctcgagaaccaatagatcttacagttgatgacagcttgttcgaggcg
tcatggacgtgcccaacttgcacactagaaaacccggccaactttttgtgctgtgatgcc
tgtacagcggagcgacctcgaccatcgaatagacgttctgtatctggacctgccaagatc
cagggaagttcaggatcccagaacaagaataagcgccggataagttatctggacagtcaa
cccactttcaaaaaccgtaccaatgccgtcgagactcttgccgcgcttgaaaggaatacc
gctaaacggccactcgggtggatctgtcaattctgcgagaccttcatggaggcggaatgg
tggacatgctcgaattgtgggacagtgaaggctagctcctaa

DBGET integrated database retrieval system