KEGG   Aspergillus oryzae: AO090005000844
Entry
AO090005000844    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K02607  origin recognition complex subunit 5
Organism
aor  Aspergillus oryzae
Pathway
aor04111  Cell cycle - yeast
aor04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    AO090005000844
   04113 Meiosis - yeast
    AO090005000844
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aor01009]
    AO090005000844
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aor03032]
    AO090005000844
Protein phosphatases and associated proteins [BR:aor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AO090005000844
DNA replication proteins [BR:aor03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    AO090005000844
SSDB
Motif
Pfam: ORC5_C AAA_16 DAG_kinase_N
Other DBs
NCBI-GeneID: 5989803
NCBI-ProteinID: XP_001817858
UniProt: Q2URF9
Position
1
AA seq 540 aa
MLPIEIPRALSQNWPCRELQTRQLASLLGPLGPSPATLVVHGISATCKSTIVRAVLSALE
VPHAIVRSTECITGRHLLTKILWATLEALGKRDEWENYGKGRCEHVSTLAVLLSECLASR
SGKAIEKFVLVLDGIDKQREAPQTLLSALARLGEIIPSLSIVLILSATPRPLFLQAAGVP
HISFPPYTRNEAISIILNSRPPTVTGLSAEVPPKIYPHFVSAIYDSLVGPTASSIPTFRS
ICEKLWPQFVSPITNGETPPGGSEEWDFSRLLLKNRGLFRHHGEAALVHHIVTEEPTSFT
NGSMSKSMLPAVSTPSPLPSLPYFPTLILTSAYLASHIPQRLDTIFFSKFSSSSLSARNK
RAHHRRRLKLLSKAQAEDARTASNDPSTPSKKGKRQKTRITKSTLESAFATSSATTSAAG
ATGITGPSTILTARPFPLERLIAIYHAIDPNPPANPILQAAVSDAIYAELATLRRLRLVV
PAAGRESGGRMGLGSGGLNSGNTTSDAGEKWCVNVSGDWIGEMAKGIGVEVGEWLAGGLD
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcttcccatagagattcctcgagcactgagccaaaattggccatgtcgagagcttcaa
accagacaacttgccagccttcttgggcctctcggtcctagtcctgcgacattagttgtg
catggtatatctgccacgtgcaagtcgaccatcgttcgcgccgtcctctccgccctcgaa
gttccacacgccattgtccgaagcacggaatgcataacaggccgccatctgttgacaaag
atactgtgggcaacattagaagcattggggaaacgggatgagtgggaaaattatggcaaa
ggaaggtgtgagcatgtcagcacgctcgctgtccttctaagtgaatgtttggcgtcaagg
tctggcaaggcaattgaaaagttcgtgcttgttttggatggtatcgataaacagcgagag
gcaccacagaccctgttgtctgcactggcgaggctgggagaaataatccccagtctctcg
attgttttgattctcagcgctactccacgaccactcttcttgcaggctgcaggtgtcccg
cacatcagtttccctccatacacgcgcaatgaagccatttccattatcttgaactcacga
ccacctacagtaaccggcctctccgctgaggtaccacctaaaatatacccccatttcgtt
tcggccatctatgactccctagttgggcctacagccagttctattcccacttttcggtcg
atatgcgagaagctctggccccagttcgtgtctcctatcacaaacggcgagactccgcct
gggggcagtgaagaatgggacttctctcgacttcttcttaaaaatcgtggtctctttcga
catcacggcgaagcggcgcttgtacatcatatcgtcaccgaggaaccgacatcttttacc
aatggttcaatgtcgaagtccatgctgccagctgtgtctacgccgtcaccactgccctcc
ctgccttatttcccaaccttgattctaacgtctgcctacttggcctcccacatccctcaa
agactagatacgatctttttctcgaagttttcatcatcttctctgtcagcacggaacaag
cgtgcccatcatcgacggcggctgaagctcttatcgaaagcccaggcggaggatgctcga
actgccagcaatgatccctccaccccaagcaaaaaaggcaagagacaaaagactcgcatc
acaaaatcgaccctggaatcggctttcgccacttcttccgctactacctctgctgctggt
gccaccggtatcactggcccatccaccattctcacagccagaccattccccttagagaga
ttaatagctatctaccacgctattgatcctaacccgccagcaaatcccatcctccaagcg
gcagtttccgatgcaatatatgcggagcttgccacactacgtcgactacggcttgttgtt
cctgctgcaggccgagaaagtggtggtcgcatgggattggggtcaggtggattgaatagc
ggaaacaccacatccgatgctggtgaaaagtggtgtgtcaatgtctctggcgactggatc
ggggaaatggccaagggtatcggggttgaagttggtgaatggttagctggaggcttggat
tag

DBGET integrated database retrieval system