KEGG   Aspergillus oryzae: AO090005000962
Entry
AO090005000962    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted transporter (major facilitator superfamily)
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 5989905
NCBI-ProteinID: XP_001817960
UniProt: Q2UR57
Position
1
AA seq 529 aa
MKKIYNVYFLCGFATLGGGLFGFDISSMSGVLGTAAYTNYFQVGSGQYKQGSITCAMPFG
SLVGALCSSFIADRYSRVRAIQFSSILWIIGSIFMCASNGIPLLVVGRVIAGGCVGIASA
MVPVYQAEIAPKEIRGRVISLQQWAITWGILIQYFIQYGASNIDGGPNNPTQSTAAFRIP
WGIQIVPGVILFFGMFLFPKSPRWLASKDRWEEALQVLSKLHGQGDVNHPKVLAEYKEIQ
EALALEREQSATGFQELIKPRIFKRVILGMSLQMWSQLCGMNVMMYYIVYIMQSTGAGSP
LLTASIQYILNTALTLPAIIYLDKFGRRPAILIGFFLQAIFLYLEGGLQGGFGAPNPHTD
PKLDAISWTVADHPAVGKAIIALSYLFVCSFATTIGPTSWTYPAEIYPAKVRAKAVSLAT
ASNWIWNCLLALFVPPLLWSINWKMYMIFAAFNTAAFIHMFLTAPETKGYTLEEMDDVFD
SGLPAWRKLERKSRMEELEKEIIEGNLKITPAHEATGVSATHVTPEKQV
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgaagaaaatctacaatgtctactttctctgtggctttgccactcttggtggtggtttg
ttcggttttgatatctcgtctatgagtggcgttctgggtactgcagcgtataccaactat
ttccaagtgggtagcggtcaatataagcagggcagtatcacctgtgcgatgcctttcggc
tctctcgtcggtgcactgtgctctagctttattgccgatcgctattcgcgtgtcagggcg
atccagttctcttccattctgtggatcattggctcaatctttatgtgtgcatcgaacggg
atccctcttttagtcgtcggtcgtgtcatcgcaggtggttgcgtcggtatcgcatctgcg
atggtccccgtctatcaggccgagatagcaccaaaagaaattcgaggacgagttatatca
ctgcaacaatgggctatcacatggggtatcttgattcaatattttattcaatatggcgcg
agcaacatcgacggcggcccaaacaaccccacgcagagtactgctgctttccgcattcct
tggggtattcaaattgtacccggcgtcattctcttctttggcatgttcctcttccccaag
tctccccgttggctcgccagcaaggaccgttgggaggaagctctgcaggtgctatcgaag
ctacacggtcaaggagacgtcaaccaccccaaggtcctcgccgaatataaggaaatccag
gaagctctggcgttagagcgggagcaatcagctactggtttccaggagctcatcaagcct
cgcattttcaagcgtgtcatcttgggtatgagcttgcagatgtggtcgcagctgtgtgga
atgaacgtgatgatgtactacattgtctatatcatgcagagcacaggcgctggatcgcca
cttctaaccgcatcaattcaatacattcttaacacggctctgaccctacctgccattatc
tacctggataaatttggccgacgcccagcaatcttaattggattcttcctccaggctatt
ttcctttacctggagggtggactgcaaggaggatttggggcgcccaaccctcataccgat
cccaagctcgatgctatttcgtggacggtggccgaccaccccgccgtggggaaggcgatt
atcgcattgtcgtatctgttcgtgtgctccttcgcgacgaccatcggcccgacttcatgg
acctatcccgctgagatctatcctgcgaaagtccgcgctaaagcagtctcgctcgctacg
gcctcgaactggatttggaactgtctcctggccctcttcgttccaccgttgctctggtcg
atcaattggaagatgtacatgattttcgctgccttcaacaccgcagccttcatccacatg
ttcctaacggctcccgaaacaaaaggttacacgctggaggagatggacgatgtctttgac
agtggacttccagcatggcgcaagctcgagaggaagagtcgtatggaagagctggagaaa
gagatcatcgaaggaaatctcaagattactcctgcacacgaggctactggcgtctctgct
acgcatgtgaccccggagaagcaagtgtaa

DBGET integrated database retrieval system