KEGG   Aspergillus oryzae: AO090005001059
Entry
AO090005001059    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; 40S ribosomal protein S25
  KO
K02975  small subunit ribosomal protein S25e
Organism
aor  Aspergillus oryzae
Pathway
aor03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AO090005001059
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aor03011]
    AO090005001059
Ribosome [BR:aor03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    AO090005001059
  Archaea
    AO090005001059
SSDB
Motif
Pfam: Ribosomal_S25 HTH_DeoR EAP30 MarR_2 HTH_24 TBPIP HTH_11
Other DBs
NCBI-GeneID: 5989983
NCBI-ProteinID: XP_023089211
Position
1
AA seq 131 aa
MHGLCPRDTTCLPTRISHLGSHFRPLIVALSSVVEQPDQTVKMAPARKKWSKGKVKDKAQ
HAVVLEKTVAERLNKDVQSYRLITVATLVDRLKINGSLARKALEDLEEKGQIKKVVGHSK
LNIYTRAVTAE
NT seq 396 nt   +upstreamnt  +downstreamnt
atgcatggtttgtgtccacgtgacactacatgtctccccactcgaatttcgcacttgggc
tctcacttccggccgttgattgtcgcgctctcatccgtcgtcgaacaaccagatcagaca
gtcaagatggctcccgcacgcaagaagtggtccaagggcaaggtcaaggacaaggcccag
cacgccgttgtcctcgagaagaccgtcgctgagcgtctcaacaaggacgtccagtcctac
cgtctcattaccgtcgccacccttgtcgaccgtcttaagatcaacggctccctcgcccgt
aaggctcttgaggacctcgaggagaagggccagatcaagaaggttgtcggccactccaag
ttgaacatctacacccgtgccgttaccgctgagtaa

DBGET integrated database retrieval system