KEGG   Aspergillus oryzae: AO090005001299
Entry
AO090005001299    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K04798  prefoldin beta subunit
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aor03110]
    AO090005001299
Chaperones and folding catalysts [BR:aor03110]
 Heat shock proteins
  GimC
   AO090005001299
SSDB
Motif
Pfam: Prefoldin_2 Rh5 Spc24 MIP-T3_C Prefoldin_3 CENP-F_leu_zip Prefoldin DHR10 Occludin_ELL DivIC TMF_TATA_bd DUF4200 Snapin_Pallidin FliJ DUF4407 COG2 DASH_Dam1 YabA TPR_MLP1_2 PHM7_cyt Rx_N DUF724 XhlA TolA_bind_tri Siah-Interact_N SOGA
Other DBs
NCBI-GeneID: 5990181
NCBI-ProteinID: XP_001818236
UniProt: Q2UQD1
Position
1
AA seq 125 aa
MADAQKQMQALSDEFQKLQTELDSLVEARQKLESQQQENQGVQKEFNSLDDDSNIYKLIG
PVLLKQDKNEALMAVNGRLEFIEKEIKRIEGQIKENQDKSDKMRAEILQYQSQMQQQAAA
ASASA
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcggacgcacagaagcagatgcaggcactctcagacgagttccaaaaattacagact
gaattggatagtttagtcgaagctcgccagaagctcgagtcgcagcaacaggaaaatcaa
ggagtccagaaggagtttaactcattggatgacgattcgaatatctacaagctcatcggg
ccggtcctgttgaagcaagataagaacgaagctctgatggctgtcaatggacgtcttgag
tttattgagaaggagattaaacggattgagggacaaatcaaggaaaaccaagacaagagc
gacaagatgcgagcagagattcttcaatatcagagccaaatgcaacagcaagcggcagct
gcatccgcctccgcttga

DBGET integrated database retrieval system