KEGG   Aspergillus oryzae: AO090009000644Help
Entry
AO090009000644    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; succinyl-CoA synthetase, alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
aor  Aspergillus oryzae
Pathway
aor00020  Citrate cycle (TCA cycle)
aor00640  Propanoate metabolism
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor01130  Biosynthesis of antibiotics
aor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AO090009000644
   00640 Propanoate metabolism
    AO090009000644
Enzymes [BR:aor01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AO090009000644
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AO090009000644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5988998
NCBI-ProteinID: XP_001817068
UniProt: Q2UTP9
Position
1
AA seq 330 aa AA seqDB search
MQAFRRSTASALRNAAAVQQRGYANAPAYAETINNLRINADTKVIFQGFTGKQGTFHAEQ
AIAYGTKVVGGTNPKKAGSTHLDRPVFANVRDAVKETGATASAIFVPPPLAAKGIEEAIE
AEVPLAVCITEGIPQHDMVRITDILKTQNKTRLVGPNCPGIIAPGQCKIGIMPGFIHKRG
RVGIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKIFLEDEETDGIIM
IGEIGGSAEEDAAEFLKANNKHNKPAVGFIAGISAPPGRRMGHAGAIVSGGKGGADSKIS
ALEAAGVIVERSPASLGKALLNEFVKRDLV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccttccgccgtagcactgcctctgcccttaggaatgctgccgctgtgcagcaa
cggggatatgccaatgccccggcctacgctgagaccattaacaaccttcgcataaatgcg
gataccaaggttattttccagggcttcactggcaagcagggaactttccacgctgagcaa
gccattgcctacggcaccaaggtcgttggtggtaccaaccccaagaaggccggctcgaca
caccttgacagacccgttttcgcaaatgtgcgcgacgccgtgaaggagaccggagctact
gcttctgctatcttcgtcccccctcccctcgctgctaagggtattgaagaagcaattgaa
gccgaagttcctttggctgtttgtatcactgaaggaattcctcagcatgatatggttcgt
atcaccgatatcttgaagacgcagaacaagactcgtctagtcggacccaactgccccggt
atcattgctcccggccaatgcaagattggtatcatgcctgggttcatccacaagcgtggc
cgtgtcggtattgtttcccgttccggtaccctgacctacgaggccgtcaaccagaccact
caggctggactcggtcagtccctcgtcgttggtatcggtggcgatcctttctccggcacc
aacttcattgactgcttgaagatcttccttgaggacgaggagactgatggtatcatcatg
atcggtgagatcggtggtagcgctgaggaggatgctgccgagttcctcaaggccaacaac
aagcacaacaagcccgcagttggattcattgccggtatcagcgctcccccaggccgtcgc
atgggtcacgctggtgccatcgttagcggcggcaaaggcggtgctgattcgaagatctct
gctcttgaagctgccggtgtcattgttgagaggagccccgcttcccttggcaaggctctg
ctcaacgagttcgtgaagcgggatctggtttaa

DBGET integrated database retrieval system