KEGG   Aspergillus oryzae: AO090010000141
Entry
AO090010000141    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ankyrin repeat
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_5 Ank_3 ChitinaseA_N
Other DBs
NCBI-GeneID: 5999315
NCBI-ProteinID: XP_023094054
Position
8
AA seq 231 aa
MPADNCGRTPLSYAAEGYEVVVRLLLDRPDIETDSKDNLGRTPLSYAAEGGYEEVVSLLL
DRQDVEADSKDNLGRTPLLYAAWRGHKAVVRRLLDRQDIEADSKDNDGLTPISCAAGGGH
EAVVRLLLDRPDVEADSKDNLGRTPLLYAAWRGHEAVVRLLLDRQDVEADSKANWGQTPL
SFAAGGGYEAVVRLLLDRPDVEADSKDNSGRTPLLYAAWRGHEAVISSKNL
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccagcggataactgtggtcggacgccgttatcctatgcagctgaaggatatgaagtg
gtggtcaggctactgttggaccgaccagatatcgagaccgactcgaaggataacttaggt
cgaacaccgttatcctatgcggctgaaggtggatatgaagaggtggttagtctactacta
gatcgacaagatgttgaggcggactcgaaggataacttaggtcggacaccgttgctatat
gcggcctggcgcggtcataaagcagtggtcaggcgattgctggatcgacaagatattgag
gcagactcaaaggataatgatgggttgactccgatatcctgtgcagctggaggtggacac
gaagcggtggtcaggctattgctggaccgaccagatgttgaggcggattcaaaggataac
ctgggtcggacaccgttgctatatgcggcctggcgcggacatgaagcggtggtcaggcta
ttgctggaccgacaagatgtcgaggcagattcaaaggctaactggggtcagacaccatta
tcctttgcagctggaggcggatatgaagcagtggtcaggctcctactggaccgaccagat
gttgaggcggactcgaaggacaactcaggtcgaacgccattattatatgcagcctggcgc
gggcatgaagcagtgatatcttctaagaatctatag

DBGET integrated database retrieval system