KEGG   Aspergillus oryzae: AO090011000509
Entry
AO090011000509    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; mitochondrial/chloroplast ribosome small subunit component
Organism
aor  Aspergillus oryzae
Motif
Pfam: Rsm22
Other DBs
NCBI-GeneID: 5998238
NCBI-ProteinID: XP_001826135
UniProt: Q2U0B3
Position
7
AA seq 859 aa
MLSRSPASRASRSCSHGLLRTIASKSSQISSQQLRGGATSFIAQRYRCTNARYEFPLNSP
VGFPRKTATGYIIGGLKNGRRYASTVPPADGNVNADRKDAIYDVIDKIEQNEMEMAELMD
ELSLLDDYWEALNLDGPELDHAFSETIGHRDQETLEARVQEARQVFGDTLPDGLLNDTEL
RLYTQLYGEPIIRQEELELEATEDEKDADVLYREDGQGGWEAVDFEQAESEDEPPVVYDM
EAGPVEDESIAMQRTREVAEQLGGEIMLEQFEEEANPDDTPRLHPLTVEGKFSTDPSTVF
LPKDTVTGPISIILSDYSNKHIADVAHRTFGGTRLPYSTTTPPPRAQMPQLPIPLDASQR
HMTEMEANAYIAALFPGMYTSILSTLVEVRKRLGTEWLRGLISKEDGPHILDASAGGAGV
LAWRDVIRAEWESMVPDHPRASPYPLGRSTVVTGSDALRMRASLLLENTSFLPRLPDYVH
IREKPTLDDERAPPKRKQYDIIVAPHSLLGIEEEFLRKEHVENLWNLLNPDGGVLILLEK
GHQKGFEAIAGAREMILKRFVSSPGSTTYTNFTESPIEDSHIEKEPGMIVAPCTNHEKCP
MFNTPGHSKGRKDYCHFQQRYIRPSFLQRILGAKDRNHEDVKFSYIAVQRGVDLRETQGI
VQGSEATEAAFAGYEDLHDPAVEEMEAPDEATSSQTEASEQAKPENFHTLSLPRIVYPPM
KRRGHVIFDFCTPAGKIERWTVPRSYSRRAYKDARKSNWGDLWALGAKTRIPRSLRLGDK
HGEGKKERLARRAALRADLAEEGELEQQSEGSDWPEVLIQQRKKGQTIPSWKKHADKKKV
RQASKKHAAAKVAQDDFLV
NT seq 2580 nt   +upstreamnt  +downstreamnt
atgctatcaagatccccagcatcaagggcgagccggtcttgctcccacggccttctgcgc
accattgcatcgaagtcgtcgcaaatcagttcgcaacagctccgcggcggagctaccagt
ttcatagcgcagcggtacagatgtacaaacgcgcgatacgagtttccccttaattcaccg
gtcggatttcctcgaaagactgctactggatacataatcggcggtctgaaaaatggacgg
cgatatgcgtctacggtgcccccggcagatggcaatgtcaatgcggatcggaaggacgcc
atctacgatgtgattgataaaattgaacaaaatgagatggaaatggctgagcttatggat
gagctgagcctgttggacgattactgggaagctctcaaccttgatggtccagagcttgat
catgcattcagcgagacgatcggccatcgggaccaggagactttagaagcgcgcgttcag
gaggcgagacaggtgttcggggacactctgcccgatggattgctgaatgacactgagttg
cggttatacactcagttgtatggcgagccgatcattcgccaggaggagttagagcttgaa
gcaacggaagatgagaaggatgcagatgttctataccgtgaagatggtcagggaggatgg
gaagctgtcgatttcgagcaggctgagtcagaggatgaaccacctgtggtctatgatatg
gaggctggcccggtcgaggatgaatctatcgccatgcaacggacaagggaagtggcggaa
cagctcggtggagaaatcatgctggagcagtttgaagaagaagcaaaccccgacgacaca
cctcgactgcatcctttgactgtggaagggaagttctctaccgatcccagtactgttttc
ttgcccaaggatacagtaactggacctatttccatcatcttgtccgactactccaataag
catattgcggatgttgcccatcgtacctttggcggtacgcgccttccttattctactacc
actcctccaccgcgcgcacagatgccccagctccctattccgctagacgcttcccagcga
cacatgacagaaatggaggcgaatgcatacattgcggctctgttccctggaatgtataca
tctatactgagcaccttggtcgaggtccgaaagcgcttgggcacggagtggctacgtggg
ctcatctcgaaagaagatgggccgcatatccttgatgccagtgctggtggtgccggtgtc
cttgcttggcgagatgtcattcgtgcagaatgggagtctatggtcccagaccatcccagg
gcaagtccttatcctttaggtagatcgactgtcgtcactggttcggatgcccttcgaatg
cgtgctagtttattgttggagaacacttcgtttctaccacgcttgcctgactatgttcac
atccgcgaaaaacctactctagatgatgagagagctcctccaaagcgaaagcagtacgat
attatcgtggctccccatagtttgctcggcatagaggaggagttcttacgcaaagagcac
gtggagaacctgtggaatcttctcaaccctgatggcggtgttctaatccttctcgagaag
ggacaccagaaaggattcgaagcaattgccggggcccgtgagatgatccttaagcgtttc
gtatcaagccctggctctacaacatataccaacttcaccgagtcaccaattgaggattca
catattgagaaggaacccggaatgattgttgcgccctgcactaaccatgagaaatgcccc
atgttcaacactccaggccattccaagggacgcaaagattattgtcatttccagcagaga
tatatcagaccgtcattcctccaacgtatcttgggagccaaggatcggaaccacgaagat
gtgaagttcagttatatcgctgtacaacgtggcgtcgacttgcgtgagacgcagggtatt
gtacaaggctcggaagctaccgaagcggcctttgctggctacgaagatttacacgaccca
gctgtagaagagatggaagcaccagacgaagctactagttcccagaccgaggcaagcgaa
caagcgaagcccgagaacttccacacgttgtctcttcctcgtattgtgtatcctccaatg
aaacgccgcggacatgtcatcttcgatttttgtacgcctgctggaaagattgagcgctgg
acggtgccccgctcctatagccgccgggcatacaaagatgctcgcaagtcaaattgggga
gatctgtgggctcttggtgcgaagacccgcatcccaagaagcttgagactcggtgataag
cacggcgaaggcaagaaagaacgtttggctaggcgggcagcccttagggccgatttagcc
gaggaaggtgaacttgagcagcagtccgagggttctgactggcctgaggtgcttatacag
cagagaaagaagggccaaacgatcccaagctggaagaagcatgcggacaagaagaaggtg
aggcaggcttcgaagaagcatgccgctgcgaaagtagcgcaggatgacttcttagtttga

DBGET integrated database retrieval system