KEGG   Aspergillus oryzae: AO090011000883
Entry
AO090011000883    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K17292  tubulin-specific chaperone A
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aor04812]
    AO090011000883
   04147 Exosome [BR:aor04147]
    AO090011000883
Cytoskeleton proteins [BR:aor04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     AO090011000883
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AO090011000883
SSDB
Motif
Pfam: TBCA DUF1910 DUF2570
Other DBs
NCBI-GeneID: 5998556
NCBI-ProteinID: XP_001826453
UniProt: Q2TZE5
Position
7
AA seq 118 aa
MAPRSQLEITTSSVLRLVKEEASYHQEYQQQTERIKKLESQQGGDDENKEYLLRQERLAL
EETKKVLPVLKKKLEDTIATLQSLLTEEGKKGPQSNVEHINAAKDAISKARTAEREIA
NT seq 357 nt   +upstreamnt  +downstreamnt
atggcgccacgctcgcaattggagatcaccacctcgtctgtcttgcgcctggtcaaggaa
gaagcatcttaccatcaagaatatcaacaacagacagagcgcattaagaaattagagagt
caacagggcggcgatgacgagaacaaagagtatctgttgaggcaagagcgtcttgcactt
gaagaaaccaagaaggtcctcccggtcttgaaaaagaagctcgaagatacgatagcgacg
ctccagagtctcctgaccgaggagggcaagaaaggaccccagagcaacgtcgagcacatc
aatgctgccaaggacgctatttcaaaggccaggacggctgagcgggagatcgcttga

DBGET integrated database retrieval system