KEGG   Aspergillus oryzae: AO090011000890
Entry
AO090011000890    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Fungal_trans Zn_clus
Other DBs
NCBI-GeneID: 5998561
NCBI-ProteinID: XP_001826458
UniProt: Q2TZE0
Position
7
AA seq 676 aa
MTSSSRSTGKRLPISCQACRTRKIRCSRDGRPCQTCVRRGLGAEDCVYLGQPRLSSENTV
TADATLQKELLARIRNLEDTLHKQAASSYMSDSLSPQMSPSVAGSFSEPDSSIGISQPDI
RSSFLGNFGTLQTFSSGYVRYLPLASQWGSVTGSAVHDVDADIPEEGDDLQIPFARNNIS
REELLAVLPPGRYCDALKDVYFRVFSPMFHILHDLTFEAEYQRFCHDPSSVSTAWIALLF
IILGIAVTALDDDDPLLSDLGREKTVSRNIKVLSTRYRSAALRCLAADGVFSRHSINSLQ
CLVLVNYARIHRGLPTWTLLGFTHHVAISMGCHVDPERFGLGPIEREERRRAWTGLMILY
INQNNTFGGPDQRIHSQDVKFPLEINDVDLLTGGTSEPAMQPTQTTYLLLEYQLSKISSM
ICETLFTFAPRFSISQIETEILAIHETCDKRYQLDASGETLPSHHLANLNTLYGHLHQLF
LLSLRPNLCRYLQGEVTPETCSARAKCAASAKATLAIYQSLHDLPQYSTYKWYNSGLGSF
HAFHAVVVLCAILMHPDSQFEFTETHDLLWRSLDAFAALSNRSNFCSKAVPVIRQLLDFV
NARNQQQQTLVPMDNTVPTSAAPSFIQPYPTPPVEYIPEPLFAQLRPQNWVSPGSVQWDG
WNFLAQEQRLRQSGLG
NT seq 2031 nt   +upstreamnt  +downstreamnt
atgacttcatcaagtcgttccactgggaagagactgcccattagctgtcaagcatgccgg
acaaggaagatccgctgttcccgagacggccgtccgtgccagacctgtgtccgacgagga
ctaggagcggaagactgtgtctacttgggccagcctcggttatcctccgagaatacagtg
acggcggatgcgactttgcaaaaggagctgctggcgcgcatccgcaatcttgaagatacg
ctgcacaagcaggccgccagttcatacatgagcgattccctttcaccacaaatgtcgcct
agtgtagctgggagcttctcggaaccagacagttctatcggcatcagccaacctgacatc
aggagctcgttcctaggcaactttggcaccctccagacgttttcttcgggctatgtccgt
tatcttccgctggcatctcagtggggttcagtgacaggaagtgcagtgcatgacgtcgat
gccgacattccagaggaaggcgatgatttacagattccctttgccagaaacaacatttcc
agagaggaattactggcggtgcttcctccgggccgatattgcgacgcactaaaagatgtc
tacttccgagtattctctcctatgttccatattctgcatgatttgacgttcgaagctgag
taccagcgattctgtcatgatccaagcagtgtaagcacggcatggattgccctcttattt
attattttgggaattgccgtcaccgccctcgatgacgatgatccactgctttccgacttg
ggtcgtgaaaagacggtcagccgcaatatcaaagtcctatcaacgcgctatcgctcggca
gcgctgcgatgcttggcagccgatggcgtgttttctcgccactccatcaactctctccag
tgcctcgtcctcgtgaactacgcaaggatccaccgtggactacctacgtggaccctgttg
ggctttacgcatcatgtagcaatctcaatggggtgtcatgttgaccccgaacgatttggc
ctgggccccatcgagcgcgaggaacgtaggcgtgcctggactggtctcatgatcctctat
atcaaccagaacaacacctttggcggtcccgatcagagaatacattctcaggatgtaaag
ttcccgttggagatcaacgacgtggacttgctcacaggaggaacatcagagcccgcaatg
cagcccactcaaacgacctacctcttgctggaatatcagctatccaagatctcttcgatg
atctgcgaaaccctcttcacgttcgcaccaagattcagcatctcgcagatcgagacggag
atcctagcaatccatgaaacctgcgacaagcggtatcaactcgatgccagcggcgaaaca
cttccaagccaccatctggccaacttaaacaccttgtacggccacctccaccagctgttc
cttctctccctccgtcctaatctatgccgctacttgcaaggcgaggttacacccgagaca
tgctctgcgagagctaagtgcgccgcatctgccaaggcaaccctggcaatctaccagtct
ctacacgacctgccccagtattccacgtacaaatggtacaacagtgggttgggaagcttc
cacgctttccacgcagtcgttgttctctgtgctattctcatgcacccggacagccagttc
gaattcaccgagacccacgatctcctctggcgatcattggatgccttcgcggcactgtcg
aaccgcagtaatttctgcagtaaggccgtgccggttatacgccagcttctggacttcgtc
aatgcccgaaaccaacaacaacaaaccttagtaccaatggacaacaccgtcccgacctca
gctgcaccatccttcatccaaccctaccccactccaccggtggaatacatcccagagcca
ctctttgctcaactccgtccccagaactgggtgagtccaggatcggtccaatgggacgga
tggaacttcctcgcgcaggagcagcgcctccgccagtcaggattgggataa

DBGET integrated database retrieval system