KEGG   Aspergillus oryzae: AO090012000496Help
Entry
AO090012000496    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; histone H4
  KO
K11254  histone H4
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aor03036]
    AO090012000496
Chromosome and associated proteins [BR:aor03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    AO090012000496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CENP-T_C Histone TAF CBFD_NFYB_HMF CENP-S TFIID-31kDa Bromo_TP UPF0137 HIGH_NTase1_ass
Motif
Other DBs
NCBI-GeneID: 5987979
NCBI-ProteinID: XP_001727505
UniProt: Q76MU7 Q2UCP9
Position
4
AA seq 103 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISAMIYEETRGVLK
TFLEGVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgtctggccgtggaaagggtggaaagggtctcggaaagggtggcgccaagcgtcaccgc
aagatcttgcgtgacaacatccagggtatcactaagcccgctatccgtcgtcttgctcgt
cgtggtggtgtcaagcgtatctctgccatgatctacgaggagacccgtggtgtcctcaag
accttccttgagggtgtcatccgtgacgctgtcacctacactgagcacgccaagcgcaag
accgtcacttctcttgacgtcgtctatgccctcaagcgtcaaggacgtaccctctacggt
ttcggtggttaa

DBGET integrated database retrieval system