KEGG   Aspergillus oryzae: AO090012000624
Entry
AO090012000624    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; NAD(P)H-nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
aor  Aspergillus oryzae
Pathway
aor00910  Nitrogen metabolism
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AO090012000624
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     AO090012000624
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 5988083
NCBI-ProteinID: XP_001727609
UniProt: Q2UCE5
Position
4
AA seq 1097 aa
MPLLEAPRNGGAVNNGVLSGVSHSQSFGIDTESHLDDPNRRQQIVVVGLGMVAISFLEKL
VKQDSERRKYDIVVIGEEPHVAYNRVGLSSFFEHRNIEDLYLNPKEWYGSFKDRSFDYHL
NTRVTDIFPDRKTVKTSTGDIIAYDLLVLATGSDAVLPTHTPGYDANGVFVYRTISDLER
LIEFASNHKGETATTVGGGLLGLEAAKAMTDLEDFGKVKLIDRNKWVLARQLDGDAGTLV
TRKIRELGLDVMHQKRVAKIKTDDNNNVTGIVFEDGEEIDCCCVCFAIGVRPRDELGTTA
GIQCASRGGFVINESLQTSIPEIYAIGECASWENQTFGIIAPGIEMADVLAFNLTNPDKE
PRSFRRPDLSTKLKLLGVDVASFGDFFADRDGPKFLPGRRPSVATIPRVKDTTEKESPVK
ALTYKDPFGGVYKKYLFTMDGKYLLGGMMIGDTKDYIKLNQMVKSQKELEVPPSQFILGA
QNGGEENGDDLADDTQVCSCHNVTKGDIVESVKSGTCKSIGEVKSCTKAGTGCGGCMPLV
QSIFNKTMLDMGQEVSNNLCVHIPHSRADLYNIVAIKQLKTFEDIMKAVGRSPDSLGCEL
CKPAIASILSSLFNGHIMDHEYHELQETNDRFLANIQRNGTFSVVPRVPGGEITADKLIA
IGQVAKKYNLYCKITGGQRIDMFGAKKQDLLDIWTELVNAGMESGHAYAKSLRTIKSCVG
TTWCRFGIGDSVGMAIRLEERYKSVRSPHKLKGAVSGCVRECAEAQNKDFGLISTEKGFN
IFVGGNGGAKPRHSELLAKDVPPDMVIPIIDRYLIFYIRTADKLQRTARWIENLPGGINY
LREVVIDDKLGICAEMEQQMQELVDSYFCEWTETIRNPKRRKYFQQFANTDETVDTVELV
KERDQERPTYWPSEGAKEDFKGHQWSALSWQPIIKADHFSDGPPAISSANVKRGDTQLAI
FKVKGKYYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNFELNGEQAGRCSNDE
AMNIATFPVEERDDGWIYLKLPPVEELDSVLGTEKWKVKKGEAPDPFQKCDKKYKGTRGK
KAGDRPSPTKQSKTIDW
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgcctctcctagaagcgcccaggaatgggggcgcagtcaacaatggcgtccttagcggg
gtgtcgcattctcagagctttggcattgacacagagagtcacttggatgaccctaacaga
cgccaacagatagtggtggtgggactgggaatggtggctatttccttccttgagaaactg
gtcaagcaagattcagagaggagaaagtacgatatcgttgtgatcggcgaagaacctcac
gttgcttacaaccgagtcggcctttcctcgtttttcgaacatcgcaatatcgaggacctc
tacctcaacccgaaagaatggtacggatcgttcaaagatcgatcgttcgactatcatctg
aacaccagagtaaccgatatatttcctgaccgcaagacggtaaaaacctcaacgggtgac
ataatcgcctacgatcttcttgttctcgctaccggctctgatgcggtgcttcccactcac
actcccggctatgacgccaacggggtttttgtctacagaacgatatcggacctcgagcgc
cttatcgaatttgcctctaatcacaagggcgagacggcaactactgtcggaggtggcctg
ctgggactcgaagctgccaaagcaatgacggatctagaagatttcggcaaggtcaagctc
attgaccgcaacaagtgggtgctagcaagacaactagacggcgatgccggtaccctagtg
acgcggaaaatcagagaactgggcttggatgtgatgcaccagaagcgagtagcgaaaatt
aagacggatgacaacaacaatgtcacgggtatcgtctttgaggatggggaagaaatagat
tgctgctgcgtctgttttgctatcggagtacgacctagagacgagttggggacgactgct
ggtattcagtgcgcttcacggggtgggtttgttatcaatgaaagtctgcaaacttcgatt
cccgagatttacgctatcggagagtgtgcaagctgggaaaaccagacgtttggtattatt
gcacctggcattgaaatggcagatgtgctagcgttcaatttgaccaatcccgataaggaa
ccaaggagcttcagaagaccggatttaagcactaagctgaagctcttgggagtggatgtc
gccagttttggtgacttttttgcggatcgcgatggccccaagttcttgccaggccgtcga
ccatcagtcgcaaccattccgcgggtgaaagacacgacggaaaaggagtcaccagtgaag
gctctcacgtacaaggatccttttggtggtgtctataagaagtatctattcactatggac
ggcaaatacctacttggaggaatgatgatcggtgatacaaaggactatatcaaactgaac
caaatggtgaagagccaaaaagagctcgaagttcctccgagccagttcattctgggagct
caaaatggtggggaagaaaacggtgacgacctagccgacgatacccaagtttgctcgtgt
cacaacgttaccaaaggtgacatcgtcgaaagtgtcaagagtggcacatgcaagtcaatt
ggagaggtaaagtcatgcacaaaggcaggcactggctgtggaggctgtatgccgttagtg
caatcaattttcaataagaccatgcttgatatgggccaggaggtttcgaataacttatgc
gtgcatattccacattcacgcgctgacctctacaatatcgtcgcaatcaaacaactgaaa
acattcgaagacatcatgaaggcagtcggaagaagccccgattctcttgggtgcgagcta
tgcaagcctgccatagcgtcaatcctttcgagtctcttcaatgggcacatcatggaccac
gaataccatgagttgcaagaaacgaatgacagattcctcgctaacatccaacgcaatgga
actttctctgtggtccctcgagttcccggtggtgaaatcactgcagacaagcttattgct
atcggacaggtggccaagaaatataacctttactgcaagatcacaggtggccagcgtatc
gacatgtttggagccaagaaacaggatctgcttgatatctggacagaattagtcaatgcc
ggcatggaaagtggtcacgcttatgccaaatctctccggacaatcaagagctgcgttggg
actacctggtgtcgtttcggtatcggagacagtgtcggaatggctattagactcgaggaa
cgctacaaaagtgttcgatctcctcacaagctcaagggcgccgtgtccggttgcgtgaga
gaatgtgctgaagcacaaaacaaagactttggtttgatctctacagaaaaagggttcaat
atcttcgtaggcgggaatggcggcgcgaagcctagacattcagaactactcgccaaggat
gtgccaccagatatggtcattccaatcattgatcgctatctcatcttctacattcgaaca
gcagataagctgcagcgaactgctcggtggatcgagaatctccctggggggatcaattac
ctccgggaagtcgtcatcgacgacaaactgggaatctgcgctgagatggagcagcaaatg
caggagttggtagacagctatttctgcgagtggaccgagactatccgcaacccgaagcgc
cgcaaatacttccagcagtttgccaacaccgatgaaacggttgacacggtggaacttgtc
aaagaacgtgatcaagagcggcccacctactggccgagcgagggcgcaaaggaggacttc
aagggacatcagtggtcggctctctcatggcagccgatcatcaaagctgatcacttctcc
gatggacctcctgcgatctcttccgccaatgtcaagcggggcgatactcagctggcaatc
ttcaaggtcaagggcaagtactacgcaacgcaacagatgtgtcctcacaagcgtgccttt
gtcctgtccgatggcctgattggcgacgatgacgccggcaaatactgggtatcctgtcca
taccacaagcgtaatttcgagctcaatggcgagcaagccggccgttgttcaaacgatgag
gctatgaatatcgcaactttcccggttgaggaacgggacgatggctggatctacttgaag
ttacctcccgttgaggagctggactctgtgctggggacagaaaaatggaaggtaaagaaa
ggagaagcaccagatccattccagaagtgtgataagaagtataaggggacgagaggcaag
aaggcgggtgatagacctagcccgaccaaacaatctaagacgattgactggtaa

DBGET integrated database retrieval system