KEGG   Aspergillus oryzae: AO090012000796
Entry
AO090012000796    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ribosome biogenesis protein - Nop58p/Nop5p
  KO
K14565  nucleolar protein 58
Organism
aor  Aspergillus oryzae
Pathway
aor03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AO090012000796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aor03009]
    AO090012000796
Ribosome biogenesis [BR:aor03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    AO090012000796
SSDB
Motif
Pfam: Nop NOP5NT
Other DBs
NCBI-GeneID: 5988224
NCBI-ProteinID: XP_001727750
UniProt: Q2UC04
Position
4
AA seq 578 aa
MTLFILTETSAGYALLKAKDKKLLKRDDLATEAATAEGVSNLVKLKSFQKFDSAATALEE
VASLVEGKVTPRLASLLDEVKDEKKVSLAVADPKLGNAIGKLPGLDIQLIADSTTTDIYR
AIREHLPTLIPGLAPQDMSTMSLGLSHSLARHKLKFSPDKIDTMIVQAIGLLDDLDKELN
NYAMRVKEWYGWHFPELAKILNDNLAYAKLVLKMGMRTNWESSDLAEILPEELEGSVKAA
ADRSMGTEISEEDLENIQALAEQVVGFTEYRQQLAGYLTARMNAIAPNLTALVGELVGAR
LIAHAGSLTNLSKSPASTLQILGAEKALFRALKTKHDTPKYGLIYHASLIGQATGKNKGK
MARVLAAKASLGIRVDALAEWDEDATEEDKAALGIEARFNLERKLAGMEGKPLKPRGVTI
APNGTPAQAKKFELNEARKYNADADAVDEPSSAKKQKKLVEEVQDTEMADADSDAEADSS
DESEEESSKKKSKKSKDADLEKMAEKAGLSLKRYKRKLERGEIEFDAEGNPSSISKKDLK
KAKKEAKKADKGEEKKRKRSDDNEDNEKKQKKKKKKDE
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgacgctgtttatcctcaccgaaaccagcgcgggttatgccctgctcaaggccaaagac
aagaagcttttgaagagagatgatctggctacggaggctgcgacggcagagggtgtttcg
aaccttgtgaaattgaagagtttccagaagttcgacagcgctgctacagccctggaggaa
gttgcttctcttgttgagggcaaggtcacccctcgtcttgccagccttcttgacgaggtc
aaggatgagaagaaggtctctttggccgttgcggacccgaagcttggaaatgccattggc
aaacttcccggtctcgatatccaacttatcgccgactcgaccaccactgatatctaccgt
gctatccgtgaacatctccccacattaatcccaggcctcgcccctcaggacatgtccacc
atgtctctgggtctttcccactcccttgccagacataagctgaagttctctcccgataag
attgatactatgattgtacaagccattggtctgctggatgatttggataaggagctcaac
aactatgctatgcgtgtgaaggaatggtacggctggcacttccctgagctggctaagatt
ctcaacgacaacctggcctatgcgaaactcgttctgaagatgggcatgcgcactaactgg
gagtcctctgatctcgccgagatcctacccgaggagcttgagggctctgtcaaggctgcc
gcggaccgctccatgggtactgagatcagcgaggaggatctggagaacattcaggctttg
gctgagcaggttgttggcttcacggagtaccgtcagcaacttgccggttatttgaccgcc
cgtatgaacgccattgcgcctaacttgactgctcttgttggcgaattggttggcgcccgt
ctcatcgctcacgccggtagcttgaccaatctctccaagagccccgccagtaccctccag
attcttggagccgagaaggcccttttccgtgccctgaagaccaagcacgacacccctaag
tatggtctcatctaccacgcctccctcatcggccaggctactggcaagaacaagggtaag
atggccagagttctcgctgccaaggcctctcttggtatccgtgtggatgcccttgctgag
tgggatgaggatgctaccgaggaggataaggctgccctgggtatagaggctcgtttcaac
cttgagaggaagctggctggaatggaaggcaagccccttaagccccgcggtgtgaccatt
gctcccaacggtacacctgcacaggccaagaaatttgaactcaacgaggccaggaaatac
aacgctgatgccgatgctgttgatgagccttcttctgccaagaagcagaagaagcttgtt
gaagaggtccaggataccgagatggccgatgctgattcggatgcagaggctgactcatct
gatgagtcggaagaggaatcgagcaagaagaagtccaagaagagcaaggacgctgacctt
gagaagatggccgagaaggccggattgagcctcaagcggtacaagcgcaagcttgagcgc
ggagagatcgagttcgatgccgaaggcaaccctagctcaatcagcaagaaggatctgaag
aaggccaagaaggaggccaaaaaggctgacaagggcgaggagaagaagcgcaagcggtcc
gacgacaatgaggacaacgagaagaaacagaagaagaagaagaagaaggacgagtaa

DBGET integrated database retrieval system