KEGG   Aspergillus oryzae: AO090012000927
Entry
AO090012000927    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation)
  KO
K17617  CTD nuclear envelope phosphatase 1 [EC:3.1.3.16]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aor01009]
    AO090012000927
Enzymes [BR:aor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     AO090012000927
Protein phosphatases and associated proteins [BR:aor01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   AO090012000927
SSDB
Motif
Pfam: NIF ATP-grasp HTH_22
Other DBs
NCBI-GeneID: 5988341
NCBI-ProteinID: XP_001727867
UniProt: Q2UBN7
Position
4
AA seq 510 aa
MNSLNILSSRVIGQSSHSNRNRQRSRSQGDIPPVTAPADLSKLRSYSSHDFHSADVFEKS
SDDGSGLTHAEDQLGLTFDEKSPLIRGLQKDGSFATKSTLGLVAQRFFDAVAEAIKFILS
TLAAPGIFAIECFHEDDGRYSPIAPARKLGRFLFGSSASSANTSAKGVKRTESRRRQGST
RKLRSHRSRDSIASSTSESEGDRKGLKGSSGNKSRSSKAKSSKSDQMSDESTPRRSIRIK
LHNEEALKRQRQRRSQSVDLDQSSDTGPLNPDSLKSPTSSSIHKVTRYPHSPVPPRPLIP
PRLPSYTATSRTYRAPQKTLILDLDETLIHSLAKGGRMSSGHMVEVKLAAPMTTALSPGA
PPTTLGPQHPILYYVHKRPHCDEFLRKICKWYKLVIFTASVQEYADPVIDWLEQERKYFH
ARYYRQHCTFRNGAYIKDLSSVEPDLSKVMILDNSPMSYIFHEDNAIPIEGWINDPTDNG
LLHLVPMLEALQYVTDVRAFLALRRGEAEA
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgaactcgttgaacatactttcgtcccgagtcattggccaatcttcccattcaaaccgt
aaccgtcagagatcacgttcgcaaggagatatcccaccagtaactgcaccggcggacctc
tccaaactccggtcttacagcagccacgacttccattcggcagacgtttttgagaaaagt
agcgacgatgggtctgggttaacgcatgcagaggaccagcttggccttacgtttgatgag
aaatcaccactgatacgagggcttcaaaaagacggttcattcgctacaaaaagtacacta
ggtcttgttgcccagcggtttttcgacgcagttgccgaagcaatcaagttcatcttgtcc
actttggccgcacccggtatatttgcaatcgaatgctttcacgaggatgacgggcgttat
tcccccatagctcctgcgagaaagttggggcgatttctattcggttcctctgccagcagt
gcaaacacatcagcgaaaggtgttaaacggacggaaagtagacgacggcagggctccacg
cgaaagctgagaagccataggtcgcgagattctattgcctcgagcacttctgagtccgaa
ggtgatcggaagggcctgaagggctcctcaggtaataaaagtcgatcttcgaaagcgaaa
tcttcaaagtcggaccagatgtcggatgagagcacccctcgtcgttctatacggatcaag
cttcataacgaagaagctctaaaacgacaaaggcagcgccgatcacagagtgtggacctc
gatcagtcgtcagataccggacccctaaacccagatagcctgaaatcgccaacctcttca
tctatccacaaggttacaaggtaccctcactcacccgtacctcctcggccgctgatccca
ccccgtctaccatcctacacggccacttcgcgcacatatagggctccccaaaagaccttg
atccttgatttggatgaaactctcatccactcactggctaaaggaggacgcatgtctagt
ggccacatggttgaggttaaattggccgcgccaatgacgactgctctcagcccgggggca
ccgccgacgaccttaggaccacaacaccccatcttgtattatgtgcacaaacgaccccac
tgtgatgaatttctgcgcaagatctgtaaatggtataagctggttatcttcactgctagt
gttcaagaatatgccgaccctgtgatcgactggctggagcaagagcgaaagtatttccat
gcgcggtactaccgccagcattgtactttccgtaatggtgcctacatcaaggaccttagc
tcggtagagcctgatttgagcaaagtgatgatcttggataacagtcctatgagctatatt
tttcacgaagataatgcgattcccattgagggctggatcaacgacccaacggataacggc
ctcctccatctcgttcctatgctagaagctttgcaatatgtgaccgacgtacgggccttt
ttggcgttacgtagaggagaagcagaagcatag

DBGET integrated database retrieval system