KEGG   Aspergillus oryzae: AO090012000957
Entry
AO090012000957    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
  KO
K23336  armadillo repeat-containing protein 8
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aor04121]
    AO090012000957
Ubiquitin system [BR:aor04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    AO090012000957
SSDB
Motif
Pfam: Arm
Other DBs
NCBI-GeneID: 5988369
NCBI-ProteinID: XP_023091604
Position
4
AA seq 1012 aa
MTRASTPPILLELQSADSLSSQASALRTLKNETIGHDQRKEAWIRWGIIPILAKVLASRQ
TNGKNTELNGPTKSQQPSSRNPEEDETCLQAIIILGSIAQGGAAFLSPILSSGILSILLS
ILSSPDCPQSFVLPILRTLNNIADRLPLQSQQQWPKDTRLADLLFSDEHISCLSRILEQD
YSTYQAQASIELAAALIGKLCTEETHKAILADCGVLDALAVKVASFIVAQGFVLPGAEAH
VQESGALGSLPPPAPPSAKLAPILRATTVIIEHSKWRAEHFLSSPGIVTVFPKQVPGFAP
SDIKTGPWGSTYLSGSAVPRHAGASPLEHLLPSVPLSQGKASASATNFPPLGQPHGPQRR
HSHSFPTPFSILEAPNSDDDENAIVPWLLYTIRAECGMVRLMAARLVTVLYRLGLTKKLR
VSMLCYLLIPILIRMLDKDYEITGDDGVQYGGLILSTDRLKEEAPAVLATLVIDDQELQK
HAVDGGAIKRLSQLLKETYNPIQENAKPMWHVDGGEKVEITCTQSAECMLGPPGYSPIHC
HVMRYRENILKALAALVPFKDEYRKTICDNGVVPYIIDSLKPCPNDPRDTSNPKNTAADG
NPTPTLLAACGAARMLTRSVSVLRTSLIDAGVATPLFTLIRHQDIEVQIAATSVICNLAL
DFSPMKEAIISAEVLPTLCEHAHSTNTRLRIESLWALKHVAYNSTNDVKMKVINGLGPTW
IQQIITQDPISALAKRGLDDEMESGTSTGMSRANSAGEQVDLLNPVEDTQEPDEDMKMAD
TLPPSKMSLEMFLPDVSRRRKLALHGDLDQTTQARQDDIAVQEQTFDLLRNLVCGPGASE
MIDHLFKEIGQDLILDALADKLRPRTIQVPHKRESSTHRALQVPTEILVAVTYVIIHLAA
SLPWHRQLLVSHRDLLRYLMGYFEHANRDVRTNCVWVVINLTYEDDSSDRDGCRERAYKL
LSVGVMDRLKRLEEDPDLDVRERTKTALHLLSCWASVVFAEYIQYNRYLSYR
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgactcgcgcttcaacacctccgatacttttggaacttcaaagcgcagattccttatcg
tctcaggcttcggcacttcgaacccttaaaaatgaaacaattggccatgatcaacgcaaa
gaagcctggatccggtggggtataatccccatactagccaaggtccttgcctccaggcaa
actaacggaaagaacaccgagctcaatgggccgaccaaaagccaacagccatcgagtcgc
aatccggaggaagacgaaacgtgcctacaggcaattatcatacttggtagtatagcacaa
ggcggtgcggctttcctttcccctatcctttctagcggcatcctctcgatcctcctgtct
atattgtcatctcccgattgccctcaatctttcgttctccctatactgcgaaccctgaat
aacatcgcggatcggctaccactgcaaagccaacaacaatggccgaaagatacacgttta
gccgatttgctcttctcagacgaacatatcagctgtctgtcacgcattctcgagcaggac
tatagcacttatcaagcgcaggcatccattgaacttgctgctgcccttatcgggaagctt
tgcacagaagaaacccataaggcaatcttggccgattgtggcgtgttggatgcgctggct
gtgaaggtggcatcgtttatcgttgctcagggttttgtacttccaggtgcggaggcacat
gtgcaggagtctggtgctcttggttctctccctccccctgcacccccaagtgccaaactg
gctccgatccttcgtgctaccacggtcattattgaacactctaaatggcgtgcggagcat
tttctctcatcgcctggcatagtgactgttttccccaagcaggtgcctggatttgctcct
tctgatatcaagacaggcccgtggggatcgacatatctctcgggctcagctgtgccacgt
cacgccggggccagtcccctcgagcatctcctaccatcggttccactgtctcaaggaaaa
gcttctgctagtgctaccaactttccacctcttggtcagccacatggaccccaacgccgg
catagccattcattcccaacccccttctcgatcttggaggcgccgaactctgatgacgat
gagaatgccatcgttccttggcttctatatactatccgtgccgagtgtggcatggtgcgg
ttgatggcagcacgtctggtcacagttctataccgtctaggtctaacgaagaagcttcga
gtctctatgctttgctacttgttgattccaattcttatccgaatgcttgataaggactat
gagataactggcgatgatggcgttcaatatggaggactgattctgtccactgaccgtctg
aaagaggaagccccggcggttcttgctaccctggtgattgacgatcaagagctgcagaag
catgcagtcgatggaggtgctattaaacgactatctcagctactgaaagaaacctataat
ccaattcaagagaacgcgaaaccgatgtggcatgtcgatggcggggaaaaggtcgagatt
acttgcacacaatcagcagagtgcatgctgggtcctccagggtattctcccattcattgt
catgtcatgcgataccgggagaacattcttaaggctttggccgctctggtgcctttcaag
gatgaataccgcaagactatctgtgacaatggggtagtcccctatatcattgattcgctc
aaaccgtgcccgaacgatcctcgagacacatctaatccgaaaaacaccgctgctgatggc
aaccctacaccaaccctattagcagcttgtggtgctgcacggatgctcactcgctcggtt
agcgtattaagaaccagcctgattgatgctggagtagccactcctttattcaccttaatt
cggcaccaggatatagaagttcagattgcggcaacgtcagttatatgtaatcttgcgctg
gactttagtccaatgaaagaggcaattatatccgcagaggtccttccaacattatgtgag
catgcacattctacgaacacaaggctccgaattgaatcgctttgggcgttgaagcatgta
gcctataactcgaccaacgatgtcaagatgaaggtcattaacggcttgggacctacgtgg
atccagcaaatcataacgcaagacccaattagtgctctagctaaacgagggctggatgat
gagatggaaagcggcacctcaacgggcatgagtcgagccaactccgcaggagaacaagtt
gatctattgaatcctgtcgaggacacacaggaacccgatgaggatatgaaaatggccgat
acattaccgccgtctaagatgagcttagagatgttccttcccgatgttagccggcgtcgc
aagcttgcgctgcatggggacctcgaccaaaccactcaagcacgccaagatgatattgcc
gtacaagaacagacctttgatctcttgcgtaatcttgtttgtggtccgggtgcatcagag
atgattgatcatttgttcaaggagatcgggcaggatttgatattggatgcactggcggat
aaactacggcctcgtaccattcaagtgccacataaacgagaatcatctacccacagagct
ctccaagttccaacagagatcctggtggcagtcacgtatgtgatcatccacctcgctgct
agcctcccatggcaccgccaacttttggtctcacatcgtgatctgttacgttatctcatg
gggtacttcgagcacgccaaccgtgatgtgcggacgaattgtgtgtgggtagtgatcaat
cttacatatgaagatgactcgagtgatcgagacggctgccgtgagcgagcatacaaactg
ctttctgttggggtgatggaccggttgaagcgcttagaagaggacccagatcttgatgtc
cgagagcgaaccaaaacagccttacatttgctatcctgctgggcgagtgttgtgtttgcg
gagtacatacagtacaataggtacctatcttatcgataa

DBGET integrated database retrieval system