KEGG   Aspergillus oryzae: AO090020000309
Entry
AO090020000309    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; sorting nexin SNX11
  KO
K17918  sorting nexin-3/12
Organism
aor  Aspergillus oryzae
Pathway
aor04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AO090020000309
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:aor04990]
    AO090020000309
Domain-containing proteins not elsewhere classified [BR:aor04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   AO090020000309
SSDB
Motif
Pfam: PX
Other DBs
NCBI-GeneID: 5996732
NCBI-ProteinID: XP_001824646
UniProt: Q2U4K2
Position
6
AA seq 142 aa
MQAVPESRQQTFEEIYGPPENFLEIEVRNPQTHGTSRNMYTSYEIVCRTNIPAFKLKHSV
VRRRYSDFEYFRDILERESTRVTIPPLPGKVFTNRFSDDVIEHRREGLQRFLQIVAGHPL
LQTGSKVLASFIQDPNWDRNAW
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcaagccgtcccggagtcgcgacagcagacctttgaggaaatctacggtcctccggag
aatttcctcgagattgaggtccgaaacccccagacccacggcacatcccggaacatgtac
acctcgtacgaaatcgtctgtcgcaccaacatccccgcattcaagctcaagcactccgtc
gtgcgccgccgctactccgactttgaatacttccgcgatatcctggagcgcgagagcacg
agggtgactatcccgccgctgcccgggaaggtgtttacgaatcggttcagtgacgatgtc
atcgagcaccgcagggaggggttgcagcggttcttgcagattgttgccggtcatccgctt
ttgcaaacagggagtaaggttttggcgagctttatacaggatccgaactgggaccgcaat
gcttggtag

DBGET integrated database retrieval system