KEGG   Aspergillus oryzae: AO090020000337Help
Entry
AO090020000337    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; phospholipase/carboxyhydrolase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
aor  Aspergillus oryzae
Pathway
aor00670  One carbon pool by folate
aor00790  Folate biosynthesis
aor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AO090020000337
   00670 One carbon pool by folate
    AO090020000337
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AO090020000337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FSH1 Abhydrolase_6 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 5996755
NCBI-ProteinID: XP_001824669
UniProt: Q2U4H9
Position
6
AA seq 282 aa AA seqDB search
MSKQPLKLLMLHGYTQSGPLFHAKSRALIKHLTKAFPLHDVTATYPTGPLRLNPADIPGY
EPTQETPTEPLEAYGWFRRSNTASPPEYLGLEDGLAAVAKVMSEEGPFDGVIGFSQGAAM
AAMVVSLLEPGRKEAFARFLDANVASEGKGETDAVVAGVPFPKAFEGLSHPPFKFALCYS
GFRSPGARYRGFYESPALQTPILHVLGSLDAVVEESRSRALVEACAGDPEKEGKVVWHPG
GHFLPSQRPYLDAAVRFIREQLEGGNKKDAEEEDVNDMDLPF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacccctcaaactcctaatgctacacggctacacccaatccggccccctc
ttccacgccaaaagccgcgccctaatcaaacacctcacgaaagccttccccctccacgac
gtaacagcaacctacccaaccggccccctacgcctcaaccccgccgacatccccggctac
gaacccacccaagaaacccccactgagcccctcgaagcctacggctggttccggcgctcc
aacaccgcctcgccgcccgaatacctcggtctcgaggacgggctggcggccgtcgcaaaa
gtgatgtccgaggaggggcccttcgacggcgtgatcgggttctcgcagggcgcggccatg
gccgccatggtggtttcgttgctcgagccgggtcggaaggaggcgtttgcgaggtttttg
gatgcgaatgttgcgtcggaggggaagggtgagaccgatgctgttgtggctggggtaccg
tttccgaaggcgtttgaggggttgagtcatccgccttttaagtttgcgctgtgttatagt
ggatttcgctcgccgggggcgcggtatcgagggttttatgagagtccggcgttgcagacg
ccgattttgcatgttttggggtcattagatgctgttgttgaggagtcgaggagtagggcg
ttggttgaggcttgtgcgggagatccggagaaggagggtaaggttgtgtggcatcctggt
ggacatttcttgccgagccagaggccgtacctggatgctgcggtgaggtttattagggag
cagttggagggcggtaacaagaaggatgcggaagaggaggatgtgaatgatatggacttg
cccttttag

DBGET integrated database retrieval system