KEGG   Aspergillus oryzae: AO090020000626
Entry
AO090020000626    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; elongation factor-type GTP-binding protein
  KO
K21594  translation factor GUF1, mitochondrial [EC:3.6.5.-]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aor03029]
    AO090020000626
Enzymes [BR:aor01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     AO090020000626
Mitochondrial biogenesis [BR:aor03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AO090020000626
SSDB
Motif
Pfam: GTP_EFTU LepA_C EFG_C Ras MMR_HSR1 GTP_EFTU_D2 MMR_HSR1_Xtn EFG_III RF3_C SRPRB RsgA_GTPase Roc Snurportin1
Other DBs
NCBI-GeneID: 5997000
NCBI-ProteinID: XP_001824914
UniProt: Q2U3T4
Position
6
AA seq 664 aa
MRGCLQLARWLSAGPKCPAASLPKAPSGLYNTIRSFTSSAQLASRARAASKPASDLETRI
AQIPIDRYRNFCIVAHVDHGKSTLSDRLLELTGTIQPGSNKQVLDKLDVERERGITVKAQ
TCTMIYNHNGEDYLLHLVDTPGHVDFRAEVSRSYASCGGALLLVDASQGIQAQTVANFYL
AFAQGLELIPVINKVDLPSAEPEKALQQMKTSFELDTENAVMVSAKTGLNVEQLLPTVVE
KIPAPVGDTQKPLRMLLVDSWYDSYKGVICLVRIFDGEVRAGDQLVSFATGIKYYVGEVG
IMYPTETSQTVLRAGQVGYIFFNPGMKRSQEAKIGDTYTKVGSEKAVEPLPGFEEPKAMV
FVAAYPVDADHFEHLEDSINQLMLNDRSITVQKESSEALGAGFRLGFLGTLHCSVFEDRL
RQEHGASIIITPPSVPVKVMWKDGREEIVTSPARFPEEDDLRSKVAEIHEPYVLATLTFP
DEYLGKVIELCEANRGVQQTLEYFTSTQVILKYELPLAQLVDDFFGKLKGSTKGYATLDY
EESAWQPSNIVKLQLLVNKAPVDAVARVVHYSQIERLGRKWVTKFKQHVDRQLFEVVIQA
AVGRKVIARETVKPYRKDVLAKLHASDVSRRRKLLEKQKEGRKRLRAVGNVVIEQKAFQN
FLAK
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgcgaggatgcctgcagttagccagatggctgagcgcagggccgaaatgcccggcggca
agccttcccaaggcgccatccggcctctataacaccatccggtctttcactagttccgcc
cagctggcatcgcgagccagagccgcgagcaaacccgcctccgatcttgaaacgagaatc
gcgcaaatcccgatcgaccgataccgcaacttctgtatcgtcgcccacgttgaccatgga
aagagtaccctctccgaccgactgctcgaactcacgggcaccatccagccgggatccaat
aagcaagtgttagacaaactcgatgtcgaacgggaacgaggtatcacagtgaaggcacaa
acatgtactatgatatataatcataacggagaggattatctgttgcatcttgtcgataca
ccaggacacgtggattttcgtgcagaggtttcgcgcagttatgccagttgcggaggagca
ttgcttctggtcgatgccagtcagggtatccaggcacagaccgtcgcaaacttctatctg
gctttcgcgcagggcttagagttgatccccgtcatcaacaaagtagacttgccatcagcc
gaaccggagaaggctcttcaacaaatgaaaacgtcgtttgaattggacacggaaaatgcg
gtgatggtttctgctaaaacgggtctgaatgttgagcaattgcttcctactgtggtggag
aagatcccagcgcctgtgggagatactcagaagcccctacgtatgttactcgtcgactcc
tggtacgattcctacaaaggtgttatctgtttagttcgaatcttcgatggcgaagtccgg
gcaggagaccagctcgtctcgttcgcaacgggcatcaagtattacgtcggtgaggttggt
atcatgtaccccacagagacctcacagaccgttctgcgagctggccaagtcggttatatc
ttcttcaatcccggtatgaaacggagtcaggaagctaagattggcgatacctacaccaag
gttggttcagagaaagctgtggagcctcttccggggttcgaagaacccaaggcgatggtt
ttcgtagccgcgtatcccgtggatgcagaccatttcgagcacctggaggatagcatcaat
cagcttatgctcaatgacagaagcatcacagtgcagaaggaatcttccgaagctttgggt
gcaggtttcagacttggattcttaggaactctccactgttccgtctttgaggatcgtttg
cgccaggagcacggcgccagcatcatcatcacgcccccttccgtgccggtaaaggtaatg
tggaaagatggccgcgaagagattgttactagccccgctcgcttccccgaggaggatgat
ctgcgatctaaggtagcagagatccatgagccttacgtgcttgccaccttaactttcccc
gatgagtaccttggaaaggtgatcgaactgtgtgaagcgaaccgtggcgtacagcaaacc
cttgaatactttacgtcgactcaagtcattctcaagtatgaactgcctctggcacaactg
gtcgacgatttcttcggaaagcttaaaggatccaccaaaggttacgctacgctggattac
gaggagtctgcttggcagccgagcaacatcgtgaaactgcaactgttggttaataaagcc
cccgtggatgctgtcgcgcgagtcgtccactatagccaaatagaacgactgggaaggaaa
tgggtgacaaagttcaagcagcatgtcgaccgacagctctttgaggtggtcatccaagct
gctgtcggacgcaaagtcattgcaagagagactgtgaagccgtatcggaaagatgtcctg
gccaagctccatgcaagtgatgtcagtcgacggaggaagctcctggagaaacagaaagaa
ggcaggaagaggctcagggctgtcggaaacgtggtgattgaacagaaggcattccaaaac
ttcttggcgaaatag

DBGET integrated database retrieval system