KEGG   Aspergillus oryzae: AO090023000366
Entry
AO090023000366    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 5992927
NCBI-ProteinID: XP_001820925
UniProt: Q2UHP2
Position
3
AA seq 125 aa
MSSAKVYVGNLSWNTNDESLRQTFSEFGNVLDAIVMKDRETGRSRGFGFVTFSAQTEADA
AIGGLNEQELDGRRIRVNLANARPAGGSRNYGGGNGYGGGYGGGYSQGGYQGGGYQGGNY
GQGDY
NT seq 378 nt   +upstreamnt  +downstreamnt
atgtcttctgcgaaagtttacgtcggaaacctttcctggaacaccaatgatgagtctctc
cgtcagactttctcggagtttggcaacgttttggacgctatcgtcatgaaagaccgcgag
accggccgcagcaggggatttggcttcgtcaccttttccgctcaaacggaagctgatgct
gccattggaggactcaacgagcaggagctcgatggtcgccgtattagggtcaacttggcc
aacgctagacccgccggcggatcccgtaactacggtggtggcaatggctacggcggtggc
tacggtggtggctacagccagggtggctaccagggtggtggctaccagggtggtaactac
ggccagggcgactactaa

DBGET integrated database retrieval system