KEGG   Aspergillus oryzae: AO090023000728
Entry
AO090023000728    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; sterol reductase/lamin B receptor
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aor  Aspergillus oryzae
Pathway
aor00100  Steroid biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
Module
aor_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AO090023000728
Enzymes [BR:aor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AO090023000728
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5993243
NCBI-ProteinID: XP_001821241
UniProt: Q2UGS6
Position
3
AA seq 483 aa
MPSHTESKYEFGGPLGAAAITVGLPILLYVFAFTCNDVTGCPVPSLLSPRTLSWGRLKSE
IGRPLGGIWGLYSWEVTGVVLAYYLLSMFLWKILPAQEVRGTKLVQHDRPLTYRFNSFSS
SVVQLAACAIGTYLKGADFVVWTYIADNYVQLLTANILISYALSAFVYVRSFSVDTNYPN
KELRELAAGGNTGNSVYDFYIGRELNPRVSLPIFGEFDIKTWCEMRPGLTGWILLNLAFI
AKQYRTYGFISDSILFTASVQAFYVLDGQYNESGILTMIDITTDGFGFMLSFGDLVWVPF
LYSTQCRYLAVYPLHLGWTGIAAVSAVFALGLYIFRAANTQKNVFRTQPSDPSVANMPYI
QTKRGTRLLTAGWWGMSRHINYFGDWLQSMPFSLPTGLAGYTIMSAGSAAALSTDFKMLD
GREVVQGEAKGWGAIFTYFYVLYFAILLMHRERRDDAMCAKKYGEDWEEYRRIVKWRILP
WVY
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgccctctcatactgaatcaaagtatgagtttggtggacctttgggtgctgctgccatc
accgtgggcctccccattctgctctatgtctttgcctttacatgcaacgatgtaactggc
tgtccagtaccatcactactaagccctcgtaccctgagctgggggaggctaaaatccgag
attggacggcctcttgggggcatctggggtctttacagttgggaggtgacgggggtggtg
cttgcatattacctcctcagcatgttcctctggaagattctccctgcacaagaagtgcgt
ggcacaaagttggttcaacacgatcggccgttgacataccgctttaactctttctcgtct
agcgttgttcagctagctgcatgcgccattggaacatatctcaagggtgcagactttgtt
gtctggacgtacatcgcggacaattatgtgcagctattgaccgccaacattctgatatca
tacgccctttccgcgtttgtatacgtacgcagcttcagcgtggacaccaattatccaaac
aaggagcttcgtgagttagctgctggtggaaacactggtaattctgtatacgatttttat
atcggtcgtgagctgaaccctcgtgtgtctctcccaatcttcggcgaatttgacatcaaa
acctggtgcgagatgcgccccggcctgactgggtggatattgctcaacttagcatttatt
gccaagcaataccgcacctatggcttcatctccgatagtatcctcttcactgcttccgta
caagcattctacgttcttgacggacagtataacgaatccggcattcttaccatgattgac
attaccacggatggctttgggttcatgttgtctttcggagatcttgtttgggtaccattt
ctctactcaacccagtgccgatacctcgcagtctaccccttgcacctcggatggaccggt
atcgccgccgtaagtgcagtcttcgcactcggcctgtacattttccgcgctgccaacacg
cagaagaacgttttccgcacgcagcctagtgatccaagtgtggcaaacatgccgtacatt
caaaccaaacgaggaacaagactgctgacggcaggatggtggggcatgtctcgccatatc
aattactttggggactggctgcaatccatgccctttagtttgccgacaggactggcaggc
tatactatcatgtctgctggcagtgccgcagccttatcaacggacttcaagatgcttgat
gggcgggaggttgttcagggtgaggccaagggctggggggccattttcacgtacttttat
gtgctctactttgccatcctcttgatgcatcgtgaacggagagatgatgctatgtgtgcg
aagaaatacggagaagactgggaggaatacaggaggattgtgaagtggagaattctgcct
tgggtctactag

DBGET integrated database retrieval system