KEGG   Aspergillus oryzae: AO090023000793
Entry
AO090023000793    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; mevalonate kinase MVK/ERG12
  KO
K00869  mevalonate kinase [EC:2.7.1.36]
Organism
aor  Aspergillus oryzae
Pathway
aor00900  Terpenoid backbone biosynthesis
aor01100  Metabolic pathways
aor01110  Biosynthesis of secondary metabolites
aor04146  Peroxisome
Module
aor_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AO090023000793
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AO090023000793
Enzymes [BR:aor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.36  mevalonate kinase
     AO090023000793
SSDB
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C GalKase_gal_bdg
Other DBs
NCBI-GeneID: 5993300
NCBI-ProteinID: XP_001821298
UniProt: Q2UGL9
Position
3
AA seq 534 aa
MHNGRGRRKNGSVKAPKNRQRPTMSHLISEQSLPTRSKSSVASDDSVDTSDDTSAAPSFS
SSPPSTKSITNGVHRPAMARKASSPMAPAFMVSAPGKVIVFGEHAVVHGKAAMAAAISLR
SYLLVTTLTKSQRTITLNFRDIGLNHTWSIDELPWDLFHQPTKKKYYYDLVTSIDPELLD
AILPLVERISPDLPEDKRKHQRGAATAFLYLFCALGSPQHPGAIYTLRSTIPTGAGLGSS
ASICVCISAALLLQIRTLAGPHPDQPPDEAEVQIERINRWAFVGEMCIHGNPSGVDNTVA
AGGKAVIFRRGDYSKPPAVSSLPNFPELPLLLVDTRQSRSTAVEVAKVGQLKEEQPLVTE
AILDTIEKVNASAQEIIRETDSSGISKDTLERIGALIRINHGLLVSLGVSHPRLERIREL
VDFANIGWTKLTGAGGGGCAITLLRPDADPSAIRQLEEKLDEEGFAKYETTLGGDGVGVL
WPAVVRNGTDEEGGEEIDQQKFENADGPEGIERLVGVGTQEKREGWKFWKRAMH
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcacaacggccgtggacgccgaaagaacggcagtgttaaagctccaaagaatcgtcag
cgccctactatgtcacacttaatctcggaacaatcccttcccacccgctcaaaatcctcg
gtcgctagcgacgatagcgtagacacctccgacgacacctcagccgctccctccttcagc
agtagtccgccgagcacgaagtctatcaccaacggtgttcacagaccagctatggctcga
aaggcttcttctccaatggcacccgccttcatggtgtccgccccgggcaaggtcattgtc
tttggtgagcatgccgtcgtgcatggtaaagccgccatggcggcagccatctccctacga
tcctacctccttgttacaaccttgaccaaatcgcaacgcaccatcaccttaaacttcaga
gatattggattgaatcacacctggagcatcgacgagctgccgtgggacttgtttcaccaa
ccgaccaagaagaagtactattacgacctggtcacctcgattgaccccgaacttctggac
gcgatcttgcctctcgtggagcgcatctccccagacctacccgaagacaagcgaaaacat
cagcgtggcgctgcgactgcgttcctctatcttttctgtgcgttgggttccccgcaacac
cctggagcgatctatacccttcggtcgacgatcccaactggcgcggggttgggcagcagt
gctagtatatgcgtttgtatcagtgctgcactccttcttcagattcgtactctagctgga
ccgcaccccgaccaaccgcccgacgaggcggaggtgcagatcgagcgcatcaaccgatgg
gcattcgttggtgagatgtgcattcacggaaatcccagcggagtggataacacggtcgcc
gcaggcggcaaggccgtgattttcagaagaggcgattattccaaaccaccggccgttagc
tcactccccaatttccccgagctacctctactgctcgtggacactcgacaatcccgttcc
acggcggttgaagtagcaaaggtcggtcagctgaaagaagaacaaccactagtgacggag
gcgatccttgataccatcgagaaggtgaatgcttccgctcaggagattatacgggaaacg
gattcgtcaggtatttccaaggatacgctcgagcgcattggagcgcttatccgcatcaac
cacggcttgttggtctcgctgggagtctctcaccctcgactcgagcgcattcgtgagctt
gtagattttgcgaacattggttggacgaaactcaccggcgctggtggaggaggatgcgcg
atcaccctcctacgtccggatgccgacccgagtgctatccgccaattggaggaaaagctg
gacgaagaaggattcgcgaagtacgagactactctgggaggagatggtgtcggtgtcctg
tggcccgccgtggtccgcaatggaaccgacgaagaaggtggtgaggagattgaccagcag
aagttcgaaaatgcagatggccccgaaggcatcgagcgtctcgtcggtgtgggcacacag
gaaaagagagagggctggaagttttggaaacgagcaatgcattaa

DBGET integrated database retrieval system