KEGG   Aspergillus oryzae: AO090026000009Help
Entry
AO090026000009    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; polyketide synthase modules and related proteins
  KO
K15316  noranthrone synthase [EC:2.3.1.221]
Organism
aor  Aspergillus oryzae
Pathway
aor00254  Aflatoxin biosynthesis
aor01100  Metabolic pathways
aor01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aor00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    AO090026000009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:aor01008]
    AO090026000009
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.221  noranthrone synthase
     AO090026000009
Polyketide biosynthesis proteins [BR:aor01008]
 Polyketide synthase (PKS)
  Iterative type I PKS
   Fungal nonreducing PKS (NR-PKS)
    AO090026000009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ketoacyl-synt SAT Thioesterase Acyl_transf_1 Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc Abhydrolase_6 Thiolase_N
Motif
Other DBs
NCBI-GeneID: 5993539
NCBI-ProteinID: XP_001821511
UniProt: Q2UG06
Position
3
AA seq 2109 aa AA seqDB search
MAQSRQLFLFGDQTADFVPKLRSLLSVQDSPILAAFLDQSHYVVRAQMLQSMNTVDHKLA
RTADLRQMVQKYVDGKLTPAFRTALVCLCQLGCFIREYEESGNMYPQPSDSYVLGFCMGS
LAAVAVSCSRSLSELLPIAVQTVLIAFRLGLCALEMRDRVDGCSDDRGDPWSTIVWGLDP
QQARDQIEVFCQTTNVPQTRRPWISCISKNAITLSGSPSTLRAFCAMPQMAQHRTAPIPI
CLPAHNGALFTQADITTILDTTPTTPWEQLPGQIPYISHVTGNVVQTTNYRDLIEVALSE
TLLEQVRLDLVETGLPRLLQSRQVKSVTIVPFLTRMNETMSNILPVSFVSTETRTDTGRA
IPASGRPGAGKCKLAIVSMSGRFPESPTTESFWDLLYKGLDVCKEVPRRRWDINTHVDPS
GKARNKGATKWGCWLDFSGEFDPRFFGISPKEAPQMDPAQRMALMSTYEAMERAGLVPDT
TPSTQRDRIGVFHGVTSNDWMETNTAQNIDTYFITGGNRGFIPGRINFCFEFAGPSYTND
TACSSSLAAIHLACNSLWRGDCDTAVAGGTNMIYTPDGHTGLDKGFFLSRTGNCKPYDDK
ADGYCRAEGVGTVFIKRLEDALADNDPILGVILDAKTNHSAMSESMTRPHVGAQIDNMTA
ALNTTGLHPNDFSYIEMHGTGTQVGDAVEMESVLSVFAPSETARKADQPLFVGSAKANVG
HGEGVSGVTSLIKVLMMMQHDTIPPHCGIKPGSKINRNFPDLGARNVHIAFEPKPWPRTH
TPRRVLINNFSAAGGNTALIVEDAPERHWPTEKDPRSSHIVALSAHVGASMKTNLERLHQ
YLLKNPHTDLVQLSYTTTARRWHYLHRVSVTGASVEEVTRKLEMAIQNGDGVSRPKSKPK
ILFAFTGQGSQYATMGKQVYDAYPSFREDLEKFDRLAQSHGFPSFLHVCTSPKGDVEEMA
PVVVQLAITCLQMALTNLMTYFGIRADVTVGHSLGEFAALYAAGVLSASDVVYLVGQRAE
LLQQRCQRGTHAMLAVKATPEALSQWIRDHDCEVACINGPEDTVLSGTTKNVAEVQRAMT
DNGIKCTLLKLPFAFHSAQVQPILDDFEALAQGATFAKPQLPILSPLLRTEIHEQGVVTP
SYVAQHCRHTVDMAQALRSAREKGLIDDKTLVIELGPKPLISGMVKMTLGDKISTLPTLA
PNKAIWPSLQKILTSVYTGGWDINWKNYHAPFASSQKVVDLPSYGWDLKDYYIPYQGDWC
LHRHQQDCKCAAPGHEIKTADYQVPPESTPHRPSKLDPSKEAFPEIKTTTTLHRVVEETT
KPLGATLVVETDISRKDVNGLARGHLVDGIPLCTPSFYADIAMQVGQYSMQRLRAGHPGA
GAIDGLVDVSDMVVDKALVPHGKGPQLLRTTLTMEWPPKAAATTRSAKVKFATYFADGKL
DTEHASCTVRFTSDAQLKSLRRSVSEYKTHIRQLHDGHAKGQFMRYNRKTGYKLMSSMAR
FNPDYMLLDYLVLNEAENEAASGVDFSLGSSEGTFAAHPAHVDAITQVAGFAMNANDNVD
IEKQVYVNHGWDSFQIYQPLDNSKSYQVYTKMCQAKENDLVHGDVVVLDGEQIVAFFRGL
TLRSVPRGALRVVLQTTVKKADRQLGFQTMPSPPPPTTTMPISPYKPANTQVSSQAIPAE
ATHSHTPPQPKHSPVPETAGSAPAAKGVGVSNEKLDAVMRVVSEESGIALEELTDDSNFA
DMGIDSLSSMVIGSRFREDLGLDLGPEFSLFIDCTTVRALKDFMLGSGDAGSGSNVEDPP
PSATPGINPEIDWSSSASDSIFASEDHDHSSESGADTGSPPALDLKPYCRPSTSVVLQGL
PMVARKTLFMLPDGGGSAFSYASLPRLKSDTAVVGLNCPYARDPENMNCTHGAMIESFCN
EIRRRQPRGPYHLGGWSSGGAFAYVVAEALVNQGEEVHSLIIIDAPIPQAMEQLPRAFYE
HCNSIGLFATQPGASPDGSTEPPSYLILHFIAVVDVMLDYKLAPLHARRMPKVGIVWAAD
TVMDERDAPKMKGMHFMIQKRTEFGPDGWDTIMPGASFDIVRADGANHFTLMQKEHVSII
SDLIDRVMA
NT seq 6330 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatcaaggcaactctttctcttcggcgatcagacagcggattttgttcccaag
ctccgcagtttactatccgtccaggacagccctattctagccgcctttcttgaccagtcc
cactatgtcgtgcgagcccagatgctgcagagcatgaacacggttgatcacaagttggct
cgaaccgctgacctgcgccaaatggtccagaagtatgtcgacggcaaactgaccccggca
tttcgaaccgctctagtgtgcctctgccagttgggatgcttcatccgggagtatgaggaa
tctggcaacatgtacccacagcccagtgacagctacgtgctgggattctgcatgggttcc
ttggccgctgtggcggtaagctgcagtcgctccttgtcagagctgctgcctatcgctgta
caaactgtgttgattgccttccgcctcggtctttgcgccctggagatgcgggatcgggtg
gatgggtgtagcgatgatcgaggtgacccttggtctaccattgtttggggtctggatccc
cagcaagctcgtgatcagattgaagtgttctgtcagaccacaaacgtacctcagacaagg
cgcccgtggatcagctgcatctctaagaatgccatcaccctaagtggcagtccatccact
ttgagggcgttctgtgcgatgcctcagatggcccagcaccggactgccccaattcccatc
tgtttaccggcccacaatggcgccctcttcacgcaggcagatatcactactatactagac
acgacgcctactactccttgggagcaactgcccggccaaataccttatatttcccatgtc
acggggaatgtagtccagactaccaactaccgggaccttatagaggtagccttgtctgag
actctcttggagcaagtgcgactagacttggttgagactggactgccacgccttttgcaa
tctcgtcaggtcaagagcgtcaccatcgtcccattcttgactcgcatgaatgagacaatg
agcaacattctcccagtcagctttgtcagtacagagacaaggactgacaccggacgagcc
atcccagcttcaggtcgaccaggcgcaggcaagtgcaagctggctattgtgtccatgtcg
gggaggttccctgaatcaccgaccaccgaaagcttttgggaccttttatacaaagggttg
gatgtttgtaaagaggttccccgtcgacggtgggacatcaacacgcatgtggatcccagc
gggaaagcacgaaacaaaggggctaccaaatggggctgttggctggatttctcaggcgag
tttgatccccgattctttgggatctcgcccaaagaggcgccacagatggatccagctcag
cgcatggccttgatgtctacttacgaggcaatggagcgggctggtttggttcccgacacc
acgccgtcgacccagcgagaccgcattggggtcttccacggagtcaccagtaacgactgg
atggagaccaatacagcccagaacattgacacatacttcatcaccggtggaaaccggggg
tttattcccgggcgcattaacttctgtttcgaatttgccggacccagctataccaatgac
acggcctgttcatccagtctagctgccatccacctggcctgcaattctctctggcggggc
gactgtgacacggcggtggcaggaggaactaacatgatctatactcctgatggtcacaca
ggattggacaaagggttctttctttcccggactggcaactgcaaaccctacgacgacaag
gccgatggttactgccgagctgagggggtcgggacggtgttcatcaaacggctggaagat
gccctggcagataatgaccccatcctcggcgttattctagatgctaaaactaatcactca
gccatgtcggagtcgatgactcggccgcacgtgggcgcccaaatcgataacatgacggcg
gcgctgaataccactggactccaccccaatgactttagctacattgagatgcatggcact
ggcacccaggtaggggatgcggtggagatggagtcagtcctgtcggtgtttgcgccgtcc
gaaaccgccagaaaggcggatcagccactatttgtcggctcagccaaggccaacgtagga
catggagagggagtgtctggggttacgagccttattaaggttctgatgatgatgcagcac
gataccatacctcctcactgcggcatcaaaccgggcagcaaaatcaaccgcaacttccct
gaccttggagctcgcaatgtgcacatcgcctttgaacccaagccctggccacgcacacac
actccgcgcagggtgcttatcaacaacttcagtgccgcgggagggaatactgcgttgata
gtggaagacgctccggagcgtcactggccgacagagaaggatccgcgctctagtcatatc
gtcgccctgtctgcgcatgtgggggcttccatgaaaaccaacctcgaacgactgcatcag
tatctcctgaaaaacccccacactgatctcgtgcagctgtcatatactactactgcgcgt
cgatggcattatttacaccgagtgagcgtcactggcgcgtctgttgaagaagtgactcgc
aagctagagatggccatacagaacggggacggagtcagtcgacctaaaagcaagccgaag
attctctttgctttcacgggacaagggtctcaatatgcaactatgggtaagcaggtgtac
gatgcgtatccatctttcagagaggacctggagaagtttgatcggttggcgcaaagtcat
ggcttccctagctttcttcacgtctgtacttcacctaaaggggatgtggaagagatggct
cccgttgtggtgcaactggctatcacttgcctccaaatggcccttactaacctcatgacc
tacttcgggatccgtgccgatgtgacagtggggcatagtttgggtgaatttgcagccctg
tatgcggcgggagttctttcggcctcagacgtcgtttacctggttggtcaaagagcagag
ctactccagcagcgctgccaacgcgggacgcatgccatgctggctgtaaaagctacccct
gaagcgttgtcccaatggatccgggatcatgactgtgaggtagcctgtattaatggccct
gaagataccgttctcagtggcaccactaagaatgttgccgaggttcaacgcgctatgacg
gacaacgggatcaaatgcacgctgttgaaactgccgtttgccttccattctgcccaggtg
caacctattctggacgactttgaggccctggctcagggagcgacatttgccaagcctcaa
ctaccaattctctctcccttgctgcgaacagaaatccacgaacaaggcgtcgtgactcca
tcatatgtcgcgcaacattgtcgtcacaccgtagatatggcccaagctttgagatctgca
cgagaaaagggactcatcgacgacaaaaccctcgtcattgagctgggaccgaagccatta
atctcgggcatggtgaaaatgacactgggagacaaaattagcaccttacccactctagca
cctaacaaggccatttggcccagcctgcagaagattctcacctcggtctacacgggtggg
tgggatattaattggaagaattatcacgcccctttcgcctcctcccagaaggtggtggat
ctgccgagctacggctgggatttgaaggactactacatcccgtatcagggtgactggtgt
ctgcatcgccaccagcaggattgtaagtgcgccgctcctggccacgaaatcaaaacggcc
gactaccaagtgcctcctgagtcgacgcctcaccgtccatccaaactggaccctagcaag
gaggccttccccgaaatcaagaccaccacgacactccatcgagtggtagaagagacgacc
aaacctttgggcgccaccctagttgtggagacagacatatctcggaaggatgttaacggc
ctcgctcgagggcaccttgtcgatgggatccctttgtgtaccccttccttttatgctgac
atcgccatgcaagtgggccaatatagtatgcaacggctccgtgcgggacatccgggggcc
ggtgccatagatggccttgtggacgtgtccgacatggtggtggacaaagcgttggttccc
catgggaagggacctcaattgctgcgcacgacgcttaccatggagtggccgcccaaggct
gctgctactacgcgaagcgccaaagtcaaattcgccacttattttgccgatgggaagctc
gatacggagcatgccagctgtactgtcagattcacaagcgatgcacagttgaaatctcta
cgccggtctgtgtctgagtacaagacccacattcgtcagttacatgatggccatgctaag
ggacagttcatgcgatacaataggaagaccgggtacaagctcatgagcagcatggctcgg
tttaatcccgactacatgctcctagattatctggtgctgaacgaagcagagaacgaggca
gcaagtggtgtagacttctcgttgggatcgtcggaaggcaccttcgcagctcacccagct
cacgtcgatgccatcacccaggtggccggttttgctatgaatgccaatgacaatgtcgac
attgagaaacaggtctacgtcaatcacggttgggactcgttccagatctaccaaccgctg
gataatagcaagtcttaccaggtctacaccaagatgtgtcaagcgaaggagaatgatttg
gtgcatggcgatgtggtagttctggacggagaacaaatcgttgctttcttccgcggcctt
acgctgcgatcagttcctcgtggtgcactgcgtgtcgtcctgcagactacagtgaaaaag
gccgatcgccaactaggatttcagacaatgccgtcgccgccgcccccgacgacgacaatg
ccaatatcgccttataaaccagctaatactcaggtttccagccaagctattccagcagag
gccactcattctcacaccccgccacagccaaagcattccccggtaccggaaactgccgga
agcgctccagcggcaaaaggagttggtgtcagtaacgaaaagttagatgctgtaatgcga
gtcgtttcggaggagagtggaattgccctcgaggagctcaccgatgacagcaactttgct
gacatgggcatcgactctctgagctcaatggtcattgggagccgcttcagagaggacctg
gggctggacctggggcctgagttttctctttttattgactgcactaccgtgcgtgccttg
aaagacttcatgttgggaagcggggatgctggcagtggctccaatgtagaagatcctccc
ccatcagctactcccggcatcaaccccgaaatcgattggtctagcagtgcctccgatagt
atttttgccagcgaagatcacgatcattcgagtgagtccggcgccgacaccggaagtccg
cctgcacttgacctgaagccctactgccgcccctcaacttctgtcgtcctacaaggtcta
cctatggtggcgcggaaaactctgtttatgctccctgatggcggagggtctgcgttctcc
tacgcctccctgccgcgcctcaaatcagatactgccgttgtgggcctgaattgcccttat
gctcgggatcccgagaacatgaactgcacacatggagctatgattgagagcttttgcaat
gagatccggcggcgacagccacggggcccctatcacttgggcggctggtcgtccggtggt
gcattcgcttacgtcgtggccgaggcacttgttaaccaaggcgaggaggtgcattcgtta
atcatcattgatgcgcctattccccaagccatggaacaacttccccgagcattttacgag
cactgcaatagcattggattgttcgctacccagccgggggctagtccggacggctcgact
gagcctccgtcctacttaatcctacactttatcgctgtggtggatgtgatgctggattac
aagctggccccgttgcatgcgcgccggatgcccaaggtcggcatcgtctgggcggcagat
acagtcatggacgagcgggacgctcccaagatgaaaggaatgcattttatgattcagaag
cggacggaatttggtcccgatgggtgggatacgatcatgcccggggcctcgtttgacatt
gtccgagcagacggtgctaatcattttacgttgatgcaaaaggaacatgtctctataatt
agcgatctgatcgaccgggtcatggcttag

DBGET integrated database retrieval system