KEGG   Aspergillus oryzae: AO090038000317
Entry
AO090038000317    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; beta tubulin
  KO
K07375  tubulin beta
Organism
aor  Aspergillus oryzae
Pathway
aor04145  Phagosome
Brite
KEGG Orthology (KO) [BR:aor00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AO090038000317
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aor03036]
    AO090038000317
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:aor04812]
    AO090038000317
   04147 Exosome [BR:aor04147]
    AO090038000317
Chromosome and associated proteins [BR:aor03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     AO090038000317
Cytoskeleton proteins [BR:aor04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    AO090038000317
Exosome [BR:aor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AO090038000317
  Exosomal proteins of colorectal cancer cells
   AO090038000317
  Exosomal proteins of bladder cancer cells
   AO090038000317
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Other DBs
NCBI-GeneID: 5997350
NCBI-ProteinID: XP_001825255
UniProt: Q2U2U3
Position
6
AA seq 448 aa
MREIVHLQTGQCGNQIGAAFWQTISGEHGLDGSGVYNGSSDLQLERMNVYFNEASGNKYV
PRAVLVDLEPGTMDAVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDQVVDVV
RREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRMMATFSVVPSPKVSDTVV
EPYNATLSVHQLVEHSDETFCIDNEALYDICMRTLKLSNPSYGDLNHLVSAVMSGVTTCL
RFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSRGAHSFRAVSVPELTQQMFDPKNMM
AASDFRNGRYLTCSAIFRGKVSMKEVEDQMRNIQSKNQTYFVEWIPNNIQTALCSIPPRG
LKMSSTFIGNSTSIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDASISEGEEEYLEEEEPLEHEE
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcgtgagatcgttcaccttcagaccggccagtgtggtaaccaaataggtgccgctttc
tggcaaaccatctctggcgagcacggccttgacggctccggtgtttacaatggctcctcc
gatctccagctggagcgtatgaacgtctacttcaacgaggccagcggaaacaagtatgtc
cctcgtgccgtcctcgttgatcttgagcctggtaccatggacgccgtccgtgccggtccc
ttcggtcagctcttccgtcccgacaacttcgttttcggccagtccggtgctggtaacaac
tgggccaagggtcactacaccgagggtgccgaactcgttgaccaggttgtcgatgttgtc
cgtcgcgaggctgagggctgcgactgcctccagggtttccagattacccactccctcggt
ggtggtaccggtgccggtatgggtactctcctgatctccaagatccgtgaggagttcccc
gaccgtatgatggccaccttctccgttgtcccctcccccaaggtctccgacaccgttgtt
gagccctacaacgccactctttccgtccaccagcttgttgagcactccgacgagaccttc
tgtatcgacaacgaggctctgtatgacatttgcatgcgcaccctcaagctctccaacccc
tcttacggtgacctgaaccacctggtctctgctgtcatgtctggcgtgaccacctgtctc
cgtttccccggtcagctcaactctgatcttcgcaagttggccgtcaacatggttcctttc
cctcgtcttcacttcttcatggttggcttcgctcctctgaccagccgcggtgcccactct
ttccgtgccgtctccgttcctgagttgacccagcagatgttcgaccccaagaacatgatg
gctgcttctgacttccgtaacggtcgttacctcacctgctctgctatcttccgcggaaag
gtctccatgaaggaggttgaggaccagatgcgcaacatccagagcaagaaccagacctac
ttcgtcgagtggatccccaacaacatccagaccgccctgtgctccattcctccccgtggt
ctcaagatgtcctccaccttcattggaaactccacctccatccaggagctcttcaagcgt
gtcggcgaccagttcactgctatgttccgtcgcaaggctttcttgcattggtacactggt
gagggtatggacgagatggagttcactgaggctgagagcaacatgaacgaccttgtctcc
gagtaccagcagtaccaggatgcctccatctccgagggcgaggaggaatacctcgaggag
gaggagccccttgagcacgaggagtaa

DBGET integrated database retrieval system