KEGG   Aspergillus oryzae: AO090102000007
Entry
AO090102000007    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Fungal_trans_2 Zn_clus
Other DBs
NCBI-GeneID: 5994301
NCBI-ProteinID: XP_023091638
Position
4
AA seq 482 aa
MVGIPGRSKGCKTCRRRKIGCDLQEPQCGQCKKSGRHCEGFDKDIAFIHRTPQGLLRKGQ
EQCQGPAPWETSCGANSTSTKQIPPQINNAAIYVDGMLHTFLVAFLPSSPILPLSHHSNI
TVPPAPWMRIAIALPRRGPLLSTALQALCMTKIARAHGDQALLMQGMAAHTQALRALQNA
INDRNTALTDETLAAIRVLGTYELHEGTMGSVVGWTSHEEGVDQLVQLRGFNSSQYESEL
GQALFGEVRRSAMIRGLQFFKGSFFSETRWCIEPWGTKPKDYVQQLYDIGLLLPPILEEL
HTIQSLPNAPRRAQIWQRCQHLEDRFSAWHARLLTLFPTPPYWEEPAELMDRSSDIRPGP
FEASFDFLNIHVADSLDFFWALRILLHTVLRRLSGAPEQSDAIIGACACNIARSVPYFTQ
PKCGFLGVQWLIFPLKTAFSAFRQMGWEIEWEWSRGVLVAMKNRGISYGGDIVDAQWGER
VR
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggtgggtatcccaggtcgatccaagggatgtaagacatgcaggcggcggaagatcggg
tgcgacctgcaagaaccacaatgcggacaatgcaagaaaagcggccgtcactgtgagggc
ttcgacaaggatattgccttcatccaccggacgcctcagggactgcttcgcaaaggccaa
gaacagtgccaagggcctgctccttgggagacttcatgcggggcgaactctacgtcgacg
aagcaaatacccccacagatcaacaacgcggcgatctatgttgatggcatgctccataca
ttcctagtcgcttttctaccctcttcaccgattctacctctcagccatcactccaacatc
accgtgccccctgcaccatggatgcggatcgccattgctctccctaggcgcggccctctt
ctctccaccgccctgcaggctctgtgtatgaccaaaattgcgcgagcccacggcgaccag
gcattactgatgcaaggcatggccgcacatacacaggctctgcgagcgttgcaaaatgcg
atcaatgacagaaatacagcactgacggatgaaacgctggccgcgatacgggttttaggg
acgtatgagctgcatgagggcacgatgggaagtgtcgtcggctggacgagtcatgaggaa
ggggtcgaccagttggtgcagttgagaggattcaactccagtcagtatgagagcgagttg
ggccaggcactgtttggggaagttaggaggagcgcgatgatccgaggtcttcaattcttc
aaaggttccttctttagcgaaacgcgctggtgcatcgagccctgggggaccaagccaaaa
gactacgtccagcaactctacgatattgggctgcttcttccacccatccttgaagagctc
cacacaatccaaagcctgcccaacgccccgcgccgggcacagatctggcaaaggtgccag
cacctagaggatcgcttcagtgcctggcatgcccgcctcctaacccttttccctaccccc
ccatactgggaagagccggctgagctgatggaccgctccagcgacatccggccaggcccg
tttgaggcttcgtttgacttcctcaacatccacgtcgccgacagcctggatttcttctgg
gccttgcgcatcctcttgcacaccgtcctgcgtcgcctctcaggtgcgcccgaacaaagc
gatgcgatcattggggcctgtgcttgcaatatcgccaggtcggtcccgtatttcacacag
ccgaagtgtgggtttttgggcgtgcagtggttgatctttccgttaaagacggccttctcg
gcatttcggcaaatgggatgggagattgaatgggagtggagtaggggagtactagtagcc
atgaagaataggggaatctcttatggaggcgatattgtggacgctcagtggggggagcgg
gttcgatga

DBGET integrated database retrieval system