KEGG   Aspergillus oryzae: AO090102000227
Entry
AO090102000227    CDS       T01018                                 

Definition
(RefSeq) pseudouridine synthase
  KO
K15454  tRNA pseudouridine32 synthase [EC:5.4.99.28]
Organism
aor  Aspergillus oryzae
Brite
KEGG Orthology (KO) [BR:aor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aor03016]
    AO090102000227
Enzymes [BR:aor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.28  tRNA pseudouridine32 synthase
     AO090102000227
Transfer RNA biogenesis [BR:aor03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    AO090102000227
SSDB
Motif
Pfam: PseudoU_synth_2 S4
Other DBs
NCBI-GeneID: 5994496
NCBI-ProteinID: XP_001822451
UniProt: Q2UAU7
Position
4
AA seq 522 aa
MALTPVDTTLKVPPPDPVEEPPKVAVTPCEPPTGPYYFEGGFRRVSPYHYTYNTFCKERW
RGRELVDIFISEFRDRPPEYYREALEAGRVCVNGKPAGPDTKVKNGDVISHTLHRHEPPV
TSQEIGIIHEDDGLIVIDKPAGVPVHSAGRYHYNSVIEILRSERGGGWVPRPCNRLDRLT
SGVMFIAKEPKAAEMVARRLKERTVHKEYVTRVKGKFPDGVVVCDQPIMQVSPKLGLNRV
RATGKTAKTKFRRLAYYPPHDPEPVAANKDRAATPPPAYANEEEGYSIVHCLPLTGRTHQ
IRVHLQFLGHPITNDPIYSNRRVFGPGLGKSEDNGDRDKEIMERLNNMGKTEVADTVSYR
THLTAAPLVPPGTDSSVIEGIMSREHEAALVEYHKRKGERLSGEQCDVCGTELYTDPGVH
ELGIFLHAVAYSSDDGDWKYRSKMPSWALPPSGMEGPRAVPDWEPVPEEEEIVIGNGTVP
EGMEDEDKPKRRQGDVLVRGVGVVDSEKLQSNSDLLELSLST
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggctctcacgcccgtcgacacaacgctcaaggtgcctcctccggaccctgtcgaagaa
ccacctaaagtggctgtaacaccctgcgaaccacccacaggcccctattacttcgaggga
ggatttcgtcgcgtcagtccataccattacacatacaacacattctgcaaagagcgatgg
aggggtcgggaactagtcgacatctttatctccgagtttcgcgatcgcccaccagagtac
tacagagaggccctggaagccggcagagtctgcgttaacggtaaaccagccggaccggat
acgaaagtgaagaacggcgatgtcatctcgcataccctgcaccgacacgaaccccccgtc
acaagtcaggaaatcggcatcattcacgaagacgatggtcttattgtcatcgataaaccg
gctggtgtacctgtccactccgccggtcggtaccattacaactccgtaattgagatcctc
cgctccgagcgtggtggtggttgggtgccccggccgtgcaatcgactggatcggttaacc
tccggcgtgatgttcatcgccaaagaacccaaggctgcggagatggtagccagaagactg
aaagagcggaccgtgcacaaggagtacgtgactcgagtgaagggcaagttcccggacgga
gtggtggtctgcgaccagcccattatgcaggttagtccaaagctgggtctgaaccgcgtc
cgcgccaccggtaagacggcgaagacgaagttccgccgcttggcctactacccaccccat
gatccggagccggtcgcggcgaacaaggaccgggctgcgacgccgccgcctgcgtatgcg
aacgaggaggaggggtatagtatcgtgcattgtttgccgttgacgggacggacgcatcag
attcgtgtccatcttcagttcctgggccacccaatcaccaatgatccgatttattcgaat
cggcgtgtgtttgggcccggtctggggaagagcgaggataacggtgatcgggataaagag
attatggagcggttgaacaacatgggcaagactgaggttgcggatacggtttcgtaccgg
actcatcttactgctgcgccgcttgtgccgccgggcacagacagctccgtcattgagggc
atcatgtcccgcgagcacgaggctgcccttgtagagtatcacaagcgcaagggtgagagg
ctttccggcgagcagtgtgacgtctgtggcacggaactctataccgatcctggtgtgcat
gagctgggtatcttccttcatgccgttgcctactcttcggatgatggcgactggaaatac
cgcagcaagatgccttcttgggctctacccccgtccggcatggaaggtcctcgggcagtc
cctgactgggagccggtgccggaggaagaagagattgtgatcgggaatggaactgtgccg
gagggcatggaggatgaggacaagccgaagaggcgtcagggagatgtcctggttcggggc
gtcggtgttgtggatagcgagaagctgcagagcaatagcgacttgcttgagctttccttg
tcgacttag

DBGET integrated database retrieval system