KEGG   Aspergillus oryzae: AO090102000498
Entry
AO090102000498    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; aromatic amino acid aminotransferase and related proteins
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 5994706
NCBI-ProteinID: XP_001822661
UniProt: Q2UA87
Position
4
AA seq 584 aa
MAPPLDLSHHYASTTKRRQGSGIKDLYKYFFIPGIANLAGGLPNPSYFPYDTLEATVATP
QRFQPSNNGTTKKSGDDAKSSMRLIVPKESHATDVQNRIDIATALQYVTADGLPPMASFV
RQFARHHLHPNVPYAGGPETILTTGATDGFSKSIEVFTNVWNPDRDWTSQREGILCEEFV
YMNAVTTVKPRGLNVVPVAIDVQGMLARGKGGLADVLENWDFRKGRRPHLMYTITIGQNP
TGGTLSVERRKEIYALCHRYDIIIIEDDPYWNLQYPSAAALEAQHRGTPMDTASVKRNYN
AHGKSSGYEFLDSLVPSYLSLDTDGRVVRLDTFSKTIAPGCRLGWITAQPAVIERLTRVT
ETATQAPSGFVQALVAKLILGQQTDHKSTNSNKSDRSWQMDGWVRWLEGLRGGYERRMQD
MCSTLEEGRFIIASEAGLESSEESWEVVDKVQMYDFAWPTGGMFVWIKLRLDTHPLHGRY
DPARLSKALWVHLMQKPHLCLLGPGDLFAPSQETLNRSWQYYRLCFAAMPEADVKDITVR
LVDGFRAFWKKTDLDGLEGDGADISQVVQSMGMERVGNFLGSGC
NT seq 1755 nt   +upstreamnt  +downstreamnt
atggcgcctcctcttgacttatcccatcattatgcatccaccaccaaacgacgtcaggga
agcggcatcaaagacctatataagtacttcttcatcccaggcattgcgaacctggctggt
ggcttaccaaacccctcatacttcccatacgataccctcgaggctaccgtcgcgacaccc
cagcgtttccaaccttccaacaatggcacaaccaagaagtctggagatgacgctaagtca
tccatgcggttgatcgttcctaaggagagtcacgcgaccgatgtacagaatagaatcgat
atcgccacagccctgcagtatgtcacagctgatggcctcccccctatggcctcatttgtt
cgccaattcgcccgtcaccatcttcatcccaacgttccatatgccggaggtcccgaaacc
atcctcaccactggagcgaccgatggcttctcaaaatcaatcgaagtattcacgaatgtc
tggaacccagacagagactggaccagtcagcgcgagggcattctttgtgaggaatttgta
tatatgaatgctgttacaaccgtcaagccaagaggcctcaacgtcgtgccggtcgccatc
gatgtacagggaatgttggcacgcggtaaaggagggttggccgatgttcttgaaaactgg
gacttccgaaaaggacgtcgtccgcatttaatgtacaccatcacgattggccagaacccc
acgggcggtaccctatccgtcgagcgtagaaaagaaatctacgcactctgtcatcgatac
gatatcatcataatcgaggacgatccttactggaacttgcaatacccatcggcggccgcg
ttagaagcccagcatcggggcacgcccatggatacagcttcagtaaagcgcaattacaat
gcgcatggaaagtcctccgggtatgaattcctggactcgttggttccatcgtatttgtcc
ttggacacggatggacgcgttgtgcgtctcgacactttctccaagaccattgcccctggt
tgtcgcttgggctggataactgcacaaccggccgtgattgagaggttgactcgggtcacc
gaaaccgcaacgcaggcaccttcgggctttgttcaagccctggtagccaaactgattctg
ggtcaacagacagatcacaagtctaccaattcgaacaagagcgatcgtagctggcaaatg
gatggctgggtccgttggctggagggtttgcgcggtggatatgaacgacgcatgcaagac
atgtgcagcactctagaggagggtagatttattatcgcctcggaagccggcctcgagtcc
agcgaggaaagctgggaagtcgtagataaagtacagatgtatgactttgcttggcccacc
ggcggtatgttcgtctggattaagctccgtctcgacacccatcccttgcatggaagatac
gacccagccaggctttccaaggcattatgggtacatttgatgcagaaaccccacctctgt
ctcctaggtcccggagacttgtttgctccctcgcaggagaccttgaatcgttcttggcag
tattaccgactttgctttgccgctatgcctgaagctgatgtgaaggatatcacggtgaga
ttggtggatgggttccgggcgttctggaagaagaccgacttagatggtctcgagggagac
ggtgcagatatttcgcaggtggttcagagtatgggcatggagcgcgtaggaaatttcttg
ggaagtggatgttag

DBGET integrated database retrieval system