KEGG   Aspergillus oryzae: AO090102000620
Entry
AO090102000620    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; molecular chaperone (HSP90 family)
  KO
K04079  molecular chaperone HtpG
Organism
aor  Aspergillus oryzae
Pathway
aor04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AO090102000620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aor01009]
    AO090102000620
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:aor03110]
    AO090102000620
   04131 Membrane trafficking [BR:aor04131]
    AO090102000620
   03051 Proteasome [BR:aor03051]
    AO090102000620
   03029 Mitochondrial biogenesis [BR:aor03029]
    AO090102000620
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aor04147]
    AO090102000620
Protein phosphatases and associated proteins [BR:aor01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AO090102000620
Chaperones and folding catalysts [BR:aor03110]
 Heat shock proteins
  HSP90
   AO090102000620
Membrane trafficking [BR:aor04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    AO090102000620
Proteasome [BR:aor03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    AO090102000620
Mitochondrial biogenesis [BR:aor03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    AO090102000620
Exosome [BR:aor04147]
 Exosomal proteins
  Proteins found in most exosomes
   AO090102000620
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 Rad54_N
Other DBs
NCBI-GeneID: 5994812
NCBI-ProteinID: XP_001822767
UniProt: Q2U9Y1
Position
4
AA seq 699 aa
MSETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYESLSDPSKLDSGKD
LRIDIIPNKEAKTLTIRDTGIGMTKADLINNLGTIARSGTKQFMEALSAGADISMIGQFG
VGFYSAYLVADRVTVISKHNDDEQYVWESAAGGTFTLTQDTEGEPLGRGTKMILHLKDEQ
TDYLNESRIKEVVRKHSEFISYPIYLHVLKETEKEVPDEEEETKEEEGDEKKPKIEEVDE
EEEKKEKKTKTVKESKIEEEELNKTKPIWTRNPADITQEEYAAFYKSLSNDWEDHLAVKH
FSVEGQLEFRAILYIPKRAPFDLFETKKTKNNIKLYVRRVFITDDATDLIPEWLSFIKGV
VDSEDLPLNLSRETLQQNKIMKVIKKNIVKKTLELFTEIAEDREQFDKFYSAFSKNIKLG
VHEDAQNRQTLAKLLRYQSTKSGDEVTSLSDYVTRMPEHQKQIYYITGESIKAVAKSPFL
DSLKQKNFEVLFLVDPIDEYAFTQLKEFDGKKLVDITKDFELEESEEEKAEREKEEKEFE
GLAKSLKNILGDKVEKVVVSHKLVGSPCAIRTGQFGWSANMERIMKAQALRDTSMSSYMS
SKKTFEISPKSAIIKELKKKVEADGESDRTVKSITQLLFETSLLVSGFTIDEPASFAERI
HKLVSLGLNVDEEAETSEEKAAEEAPAAATGESSMEEVD
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgtccgagacttttgagttccaggctgagatctctcagctcctttctcttatcatcaac
actgtctactccaacaaggagattttcctgcgtgaacttatctccaatgcctccgatgcc
cttgacaagatccgctatgagtctttgtcggacccttccaagctcgactcaggcaaggac
ctccgtatcgatatcattcccaacaaggaggccaagaccttgactatccgtgataccggt
atcggtatgaccaaggctgacctgatcaacaaccttggtaccatcgctcgctctggtacc
aagcagttcatggaagccctctccgcaggtgccgatatttccatgattggccagttcggt
gttggcttctactctgcttaccttgtcgctgaccgcgtcactgtcatctctaagcacaac
gatgatgagcagtacgtctgggagtccgctgccggcggtaccttcacgctcacccaggac
accgagggtgagccccttggccgtggtaccaagatgatccttcacttgaaggatgagcag
accgactacctcaacgagagccgcatcaaggaggttgttcgcaagcactccgaattcatc
tcttaccccatctacctccacgttctgaaggaaaccgagaaggaggttcctgatgaggag
gaagagaccaaggaagaggaaggcgatgagaaaaagcccaaaattgaggaggttgacgaa
gaagaagaaaagaaggagaagaagaccaagactgtcaaggagagcaagatcgaggaggag
gagctcaacaagactaagcccatctggacccgtaaccctgctgatatcactcaggaggaa
tacgctgccttctacaagtctctctccaatgactgggaggatcaccttgccgtcaagcac
ttctccgttgagggtcagctcgagttccgtgccatcctctatattcctaagcgtgctcct
ttcgacctcttcgagaccaagaagactaagaacaacatcaagctctatgttcgccgtgtc
ttcatcaccgacgacgccaccgacctcatccctgagtggctcagcttcatcaagggtgtt
gttgattcagaggaccttcctctcaacttgtcccgtgagaccctgcagcagaacaagatc
atgaaggttatcaaaaagaacattgtcaagaagacccttgagctcttcaccgagattgct
gaagaccgtgagcagtttgacaagttctactccgccttcagcaagaacatcaaacttggt
gtccacgaggatgctcagaaccgccagactctcgctaagctgctccgttaccagtccacc
aagtcgggtgatgaggtcacctccctctctgactatgtcacccgcatgcctgagcaccag
aagcaaatctactacatcactggcgagtctatcaaggctgtcgccaagtctcctttcctt
gacagcctcaagcagaagaactttgaggttctcttcctggttgaccctattgatgagtac
gctttcactcagcttaaggagtttgatggcaagaagcttgtcgacatcactaaggacttc
gaactcgaggagtccgaggaggagaaggctgagcgtgagaaggaggagaaggagttcgag
ggcctcgccaagagccttaagaacatcctcggtgacaaggttgagaaggttgttgtctct
cacaaacttgttggctctccttgcgccatccgtactggccagtttggttggtctgccaat
atggagcgtatcatgaaggcccaggccctccgtgacacctccatgagctcctacatgtct
tccaagaagaccttcgagatctctcccaagtctgctatcatcaaggagctcaagaagaag
gtcgaggctgatggtgaaagcgaccgtaccgtcaagtccatcactcagcttctgttcgag
acctctcttttggtttccggcttcaccatcgacgagcctgccagctttgccgagcgcatc
cacaagcttgtgtctcttggtctgaacgtcgacgaggaggctgagacctctgaggaaaag
gccgctgaggaggctcctgccgctgccaccggtgagagctccatggaggaggttgactaa

DBGET integrated database retrieval system