KEGG   Aspergillus oryzae: AO090113000090
Entry
AO090113000090    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ankyrin repeat
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5 NACHT_sigma NACHT AAA_16 AAA_22 AAA_18 RNA_helicase
Other DBs
NCBI-GeneID: 5995926
NCBI-ProteinID: XP_001824279
UniProt: Q2U5L9
Position
5
AA seq 1056 aa
MSFTNDHGSGDMFNSHMSTQNNNTGNGNQFPGSNFPGTVNFYQSTQNERSLQSRQMDVLK
RLNVSKYRDQKDRNPVRVRGTCDWFVTHPTFRAWQETQTSQMLWVTADPGCGKSVLAKYL
ADSVLTSHAGRTVGYFFFKDDFEDQRSIVKALCCIFHQLFYQNRDLLTAHIIEQFEMDER
IVDSFGSLWNVLISAAKQTDTTEIICLLDAFDECEPDGRSQLTVALERLYTDESRHNFNL
KFLITSRLYGDIRQGFQPMQMEGQPLIHLSGEGTEEMEDISREIKTFIKARVETIGARLK
LTEEEKSILLKSVTRVPNTTYLWVYLTLNLIENIKDIDKTRILDATSDLPKTVDDAYERI
LSRSEDCQKARKLLHIVVGATRPLTLQEMNLALILSEKHQSYRELELRSEDRIRENIRDL
CGLFITVVEGKIYLLHQTAREFLIEKNKPPIQGNTSDSKLRVLHNAAWRNRFRDTHKRSN
DSIQSLSWKHSLKLQESHQIISRICIKYLLLSDFRKTLPRRIDIGELTNTYIFLDYSTRS
WATHFLEANDDTDNMKQSLVTLCDLIEDCCPAWFQVYWASLGTKFPTGFNSLMIGAYFGL
IPVVQHWIEMGKTDVDAEDDIYGRSALSWASGNGHTTVIKLLIKRSYRTWWKMARVDARD
RHNRTPLSWAIINGQVEAVSLLLKAGAVIDLKDDIGGTPLEYAICSGNNEVWNIVKKKGS
QNHHLSIDKIQTRLLISAARKGNEAIVTLLLENNADIDSRDENGQTPLSCTAENGHEAVV
RLLLENKADIDSRDENGQTPFSRAAENGHEAVVRLLLENKADIDSRDENGQTPFSRAAEN
GHEAVVRLLLENKADIDSRDENGQTPFSRAAENGHEAVVRLLLENKADIELRDRNGQTSL
SRAAKNGHKVVVRLLLEHSVDIESTDNMFGQTPLSWAARNGHEAVVRLLLENKADIESTD
NIFGRTPLSWAAGNGYEAVVRLLLENKADIDSRDENGQTPLFWAAENGYETVVRLLLENK
ADIESTDNTFSQTPLSRAARNGHEAVVRLVSRYKSP
NT seq 3171 nt   +upstreamnt  +downstreamnt
atgtcattcaccaacgaccacggcagtggggatatgttcaactcccatatgagtacccag
aacaacaatacaggcaatggcaaccagtttcccggatccaactttcctgggactgtgaac
ttctatcagagtacccagaatgagcgttctcttcaatcacgacagatggatgtcctaaag
agactgaatgtatcgaaatatcgagatcagaaagatcgaaaccctgttcgagtacgaggg
acgtgtgactggtttgttactcatccgactttcagagcctggcaagagacccagacgtcg
cagatgctgtgggtcactgcagatcctggatgtggaaaatctgtgttggcaaagtatttg
gcagattctgttctcacaagtcacgctggtcgaacagtcggatatttcttctttaaggac
gacttcgaggatcagaggagcatcgtaaaggcgttatgctgcatttttcaccagctcttt
taccagaatcgcgatctgcttactgcgcatattattgaacaatttgagatggacgaaagg
attgttgattcttttggtagtctttggaacgtcctcatcagcgctgcgaaacaaacggat
actacagagatcatttgtctgctagacgccttcgatgaatgcgaaccggatggacggtcc
caactcactgtagcactcgaaaggctttacactgatgaaagtcggcataatttcaatcta
aagtttcttattactagtcgcctctatggtgacatcagacaaggatttcagcctatgcag
atggaagggcaaccattgattcatctcagcggggaaggtactgaagaaatggaggatatc
tctcgtgagatcaaaactttcatcaaagcaagggttgaaacaattggcgcccgactaaag
ctcacggaagaggaaaagtctatcctactcaagagcgtcacacgtgttcccaacaccaca
tatctctgggtctaccttactctaaatctaattgagaatattaaggatatcgataaaaca
agaatactcgacgctacgtctgacctccccaagaccgtggacgatgcctatgaacgaatc
ttatctcgaagcgaagactgccaaaaggccagaaaattacttcatatcgtggtcggtgcg
acacggcccttaacgctccaagaaatgaacctcgctttaatcttaagtgaaaaacaccag
tcatatcgggagctcgaactcagatcagaagaccgtattcgtgaaaatatccgggacctc
tgcggactgtttattaccgttgtagaaggtaaaatttacctccttcatcaaacggcgaga
gagtttttgattgaaaagaataaacccccgatccaggggaatacatccgacagcaaactt
cgcgtgcttcataacgctgcctggcgaaaccgattccgagatacccataaacgaagcaat
gatagcattcaaagcctctcatggaagcattcactaaagctgcaagagtctcatcagatt
atttcaagaatctgtatcaagtacctgctgctctccgattttcggaagaccttgcctcgg
agaatagacataggcgagcttaccaacacctatatctttctagactactctaccagatct
tgggccactcattttttggaagcgaatgatgacactgacaatatgaaacaatcccttgtg
acactctgcgatctgatagaagattgctgtccagcttggttccaagtttattgggcgtca
ttgggcacaaaattcccgactggcttcaacagtcttatgattggagcctattttggacta
atacctgtagtgcaacactggattgagatgggtaaaactgatgttgacgctgaggacgat
atatatggccgctcggcactatcctgggcgtctgggaacggccatactactgtcataaag
ctattgatcaaaagatcctacagaacctggtggaagatggcccgggttgatgcgcgagac
aggcataataggacacctctttcgtgggctattataaacggtcaagtggaggcagtcagt
ttgttgctcaaagcaggagctgtgattgacttgaaagatgatatcggaggaacgccgtta
gaatatgccatctgcagtgggaataatgaagtatggaatatcgtgaagaagaaaggatcc
cagaatcatcatctgtccatcgacaagattcaaaccagactgctcatttcagccgccaga
aagggcaatgaagcgatagtgacactcctgcttgagaataatgcagatatagattcgagg
gatgaaaacggccaaacaccactttcctgcacggcagagaatggccatgaggcagtagtg
agactactgctcgagaacaaggcagatatagattcaagggatgaaaacggccaaacacca
ttttcccgggcggcagagaatggccatgaggcagtagtgagactactgctcgagaacaag
gcagatatagattcaagggatgaaaacggccaaacaccattttcccgggcggcagagaat
ggccatgaggcagtagtgagactactgctcgagaacaaggcagatatagattcaagggat
gaaaacggccaaacaccattttcccgggcggcagagaatggccatgaggcagtggtaaga
ctactgctcgagaataaggcagatatagagttgagggatagaaacggccaaacatcactt
tcccgggcggcaaagaatggccataaggtagtagtaaggctccttcttgaacatagtgta
gatatagagtcgacagataatatgtttggccaaacaccactttcctgggcggctaggaat
ggtcatgaggcagtggtgagactcctgctcgagaacaaggcagatatagagtcgacagat
aatatttttggccgaacaccactttcctgggcagcagggaatggctatgaggcagtggta
agactactgctcgagaataaggcagatatagattcaagggatgaaaacggccaaacacca
cttttctgggcagcagagaatggttatgagacagtggtgagactcctgctcgagaacaag
gcagatatagagtcgacagataatacgtttagtcaaacaccactttcccgggcggctagg
aatggtcatgaggcagtggtgaggctagtttctaggtacaagagcccttga

DBGET integrated database retrieval system