KEGG   Aspergillus oryzae: AO090120000129
Entry
AO090120000129    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; ubiquitin-protein ligase
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
aor  Aspergillus oryzae
Pathway
aor04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AO090120000129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aor04121]
    AO090120000129
   03400 DNA repair and recombination proteins [BR:aor03400]
    AO090120000129
Enzymes [BR:aor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     AO090120000129
Ubiquitin system [BR:aor04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   AO090120000129
DNA repair and recombination proteins [BR:aor03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    AO090120000129
SSDB
Motif
Pfam: UQ_con UEV RWD Prok-E2_B
Other DBs
NCBI-GeneID: 5996145
NCBI-ProteinID: XP_001823886
UniProt: Q2U6R2
Position
5
AA seq 149 aa
MALPKRIVKETERLMAEPVPGINAVPHEDNLRYFDVSIHGPAQSPYEGGIFRLELFLPED
YPMTPPKIRFLTKIYHPNIDRLGRICLDVLKNNWSPALQIRTILLSIQALLGAPNPDDPL
ANDVAQRWKEDEPAAIQTAREWTRTHAMT
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcgttgccgaaaagaatagtgaaggagactgagcgccttatggcggagccggtccct
ggtatcaatgctgtgcctcatgaagacaacctgcgttatttcgatgtatcgatccatggg
ccggcccaatctccatatgaaggtggtatcttccgtcttgaactgttcttgcccgaagat
tatcctatgactcctcccaagattcgattcttgaccaagatctaccaccccaacatcgac
cgtctcggacgtatctgcttggatgtcctgaagaacaactggtcccctgcgctccaaatc
cgtacaattctgctctctatccaagccttgctcggagctccaaacccagatgacccgctt
gcaaatgatgtcgctcaacgctggaaggaggatgagccggctgcgatacagaccgctcgg
gaatggaccagaacacatgccatgacttag

DBGET integrated database retrieval system