KEGG   Aspergillus oryzae: AO090120000164
Entry
AO090120000164    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: Lipase_3 Abhydrolase_6 Hydrolase_4
Other DBs
NCBI-GeneID: 5996171
NCBI-ProteinID: XP_001823912
UniProt: Q2U6N6
Position
5
AA seq 1184 aa
MPNIFGLVPMLRRAEAQPDLEVAQGDGASHIPATSGATLLPRPVASIVSFVTQSTSLSLR
VGTFFGGVAIDGARATTLTGLELSRAVIEGVLTRAGRDVATRSSGEHGRVEAESILERSL
AALHKSVTSASFFVAATFHFSSTTLSSASNMSQALLSTLDAILGSTESSRAIAAIITLIR
REFRNPRVESMTDDNIGVGDLLIGTVGFAMLQRWGRKNTERQIRTNGGEEAIWDVVILDN
GVRADVVGMHQIELTRRPRSEFHDETRRSSFISPGNDEEAFDAVQRPASRGDMAEKHPLS
LPPGDHQMSDDDIRLYIMKQLPQGCRASIKTDLVTARTITVDIYDDDSAEIAAPPGTMVI
EERFRNDQCLGSSGGSSPPQFPKHTVVFRTAFNKSQSADVRLSRGDDISGIYEISSDHGD
QSPYLSQGIAITDSLPDAESTVADHRHAKPQDKPIQTIQTEIEDGSHRNSRFPGTNGLGK
SSYEPTLLADSNSSKRYSTESTRTASNEADTISKGSFGKGSLTRIAQKVKPASVERSGQS
KRLSVKEKSSTPPVHSVQRSKGSKGYVPERKPSAPKQSPKPTAEAKSEKPPLPSKARVSS
VANRGSPRSPLQSSRLSVPSTARGTSVREMPPERGPMPEFYAIHEKNEESFMKQTDAYST
NVRPRSSAGVRTHVRSSSSMSVTRSEADMSVSVNDGRPSSSHLHRSSHTFTPSIYSLATA
GSETSLILAHRSRKSAYDDMETIQALSRDGLVPGIFPEKHFVQNIRRFLRFSSASYGSNA
LKVMGVPPTTKALAYQESDSREHSDFSDHTGLPASTILLSSFVDPAGGSKAAGETETGFP
LVHYLFLDHESKAVVLTLRGTWGFEDILTDMTCDYDDLEWQGKSWKVHKGMHASAQRLLM
GGGGKVMITIRAALEEFPDYGVVLCGHSLGGGVAALLATMISEPTNDGYGTSFVTASYQA
TAQRLLLTGSSDTNQTACFLPSGRPIHVYAYGPPAAMSPFLRRATRGLITTIVNGHDVVP
SLSLGILHDMHTVSVAFKSDVSGTKSHVQGRVWNSLRQSIVNKFYVNEPPIVQHAGDGIG
EDAWAWKTLKMLREEMLAPKLMPPGEVFVVETMRVLQRDAFTSGMGDDGHPRLGRPATRV
QLKFIRDVESVFGEMRFGSGMFSDHNPARYEASLAALSRGILDD
NT seq 3555 nt   +upstreamnt  +downstreamnt
atgcctaatatattcggccttgtgcctatgttgaggcgagctgaggcccaacctgatcta
gaagtggcccagggtgacggcgcaagccatatacccgcaacctcaggcgcaactctactt
ccacgtccagtggcttcgattgtttcctttgttacccagtccacttcgctttctctccga
gtcgggactttcttcggaggagtggccatcgatggagcaagagccaccacactgacggga
ttggagctcagtagagcagtcattgaaggcgtcctgacaagagccgggcgggatgtggct
acgaggagcagcggagaacatggcagagtagaagcagaatctatactagagcgaagcctt
gccgctctgcacaagtcggtcacgtctgcatcgttcttcgtcgctgcaacgtttcatttc
tcttccacaactctctcatctgcttcaaatatgtcccaggcgcttttgtctacccttgat
gcaatacttggctcaactgagtcttcaagggcaatagctgccatcataacacttatccga
agagaatttcggaacccaagagttgagtctatgactgatgataacattggtgtcggtgac
ctcttaataggcacagttggcttcgccatgcttcagcgttggggaagaaaaaacaccgaa
cgacaaatacgtacgaatggtggggaggaggccatctgggatgttgtcatcttagataat
ggggtcagagcagatgttgttgggatgcatcagatagaacttacgagaaggcctcggagc
gaattccacgatgagacgaggcgctcgtctttcatatcgcccggaaatgacgaagaagcc
ttcgatgctgtgcagcgtccggcgagtaggggtgatatggccgagaaacatcccctttcg
cttcccccaggagaccatcaaatgtccgacgatgacattcggttgtatattatgaagcag
cttcctcaaggctgtcgtgcctcgataaagactgacctagtcactgcacgtactattaca
gtcgatatttatgatgacgacagcgcagagattgctgctccgcccggtacgatggtgatt
gaggaaaggttccgtaacgaccagtgccttggcagcagtggaggatcgagtcctccccaa
tttcccaagcacactgttgtttttcgaacggctttcaataaatctcaaagcgcagacgtg
aggctatcacgtggagacgatatctcgggtatatacgagatcagttctgaccatggcgac
cagagtccttacttgagtcaaggtattgcgattactgactcactccctgacgccgaatca
actgtcgcagatcaccgtcatgctaaaccccaagacaaaccaatacaaaccatccaaact
gaaattgaagatggcagccatcgaaacagtcgttttccgggaaccaatggactgggtaaa
tcttcatacgagccaacgctactcgctgattcaaatagctctaaaagatatagcacagaa
tctactcgaaccgcctcaaacgaagccgacactatctcgaaaggttcgtttgggaaaggc
tccctgacgaggattgcacagaaagtgaaaccggcgagtgttgaaagaagtggtcagagt
aagcgactgtcggttaaggaaaagtctagcacgccaccggttcattccgtccaacgcagc
aagggttctaaaggctatgtccctgaaagaaaaccatcagctcccaaacaatctccgaaa
cctaccgcagaagcaaaatcggaaaagccgccacttccttcaaaggctcgagtttcgtcc
gtagcgaaccgaggctcaccaagatcgcctttacaaagctctcgactgtctgtcccttca
acagcacgaggtactagcgtacgagaaatgccccccgaaaggggtccgatgcctgagttt
tatgcgatacatgagaagaatgaagaatctttcatgaagcaaacagatgcttattctaca
aacgtgcgcccgagatcttctgccggtgtgaggacacatgtgcgtagcagcagttctatg
tccgtcacacgatctgaggcggacatgtctgtgtctgtcaatgatggacgtccaagctcc
tcacatttacacagaagctctcatacgtttactcccagcatatactccttagccacggct
ggttcagagacgtcactcatacttgcgcatcggtcccgcaagagtgcttacgatgatatg
gaaactatacaagcattaagccgcgatggacttgttccaggaatatttcccgaaaagcat
tttgtgcaaaatatcaggcgtttcctccggttttcctcggcatcttatggatcaaatgcc
ctcaaagtcatgggtgttccaccaacgaccaaggctcttgcatatcaggaatctgacagt
cgcgagcacagcgacttttcggaccacaccggcctaccagcttcgacaatccttctatca
tcctttgtcgatcccgcgggtgggtcaaaggctgctggagagacggagaccgggtttcct
ctggtccattacctgtttctagatcatgaatcgaaggccgttgtcttgacacttagggga
acatggggcttcgaagatatcctcacagatatgacctgtgattatgatgacctggaatgg
caaggaaagagctggaaagttcataagggcatgcatgcttctgcgcaacgactgttgatg
gggggaggtggtaaagttatgattacaatcagagctgccttggaggaattcccagattat
ggcgtggtactctgcggtcactcgctaggcggaggtgttgctgcactattagctacgatg
atatcggaacctacgaatgatggctacgggacatcgtttgtgactgcttcatatcaagcc
accgcgcaacgtttgctcctaactggaagcagcgacaccaaccaaacggcgtgttttctt
ccctcgggacgacctatacatgtgtacgcatatggtccgcctgcagccatgtcccctttt
cttcgccgtgcgacacgtgggttaattacaacaattgttaacggtcatgatgtggtaccc
agcctttctttaggaattttgcatgacatgcatacggtgtcagtggctttcaagagtgac
gtttcaggaaccaagtcgcacgtacaaggccgtgtctggaacagtttgcggcagagtatc
gttaataagttctacgtcaacgagccgcctatagtccagcatgctggtgacgggattggt
gaggacgcttgggcatggaagactctcaaaatgctcagagaggaaatgctcgcgcctaag
ctgatgcccccgggggaggtattcgtggtcgaaaccatgcgtgtcttgcagcgggatgct
ttcacgtcgggtatgggtgatgatggccatccgcggctaggtcgtcctgcaacgagagtc
cagctcaagtttattcgagacgtcgaatccgtctttggagaaatgagattcggatcagga
atgttcagtgaccacaatcctgcacgttatgaagcaagcctcgcggcgctctcgcgcgga
attttggatgattga

DBGET integrated database retrieval system