KEGG   Aspergillus oryzae: AO090120000253
Entry
AO090120000253    CDS       T01018                                 

Definition
(RefSeq) unnamed protein product; predicted protein
Organism
aor  Aspergillus oryzae
SSDB
Motif
Pfam: DUF5102
Other DBs
NCBI-GeneID: 5996249
NCBI-ProteinID: XP_023092476
Position
5
AA seq 401 aa
MERYLVPKPSDSDARSPSHSPELNERGLKEGISTDADVPETVLQRVDTLPNEDTGSSPRA
HQRRPSDALPDVTETVPDGPDAPSPLQDSLPQQSHDKQETPVAGDDSANQAATDDFDDFA
EEQDMGEDDFGDFDDFDDGFQEPSTEVSDEEPVVQTPQLHTLPTVPPLVDFDSCQSLPDV
FAALDEPLDRLFPASNEVSSLPPIEPLRNNSAIFNTERSLSLWSQLVAPPPLQPQNWVKS
RIRRLFLVSLGVPVDLDEILPASKQKKLVLPSINPGGPDATSGTHSRSGSQVRKDDVQSG
ANSPSTSGPPRNRASWRREPSPPPQLDLPAVRRLCSTTDAALDGLTDGELQGHVKELENV
TLRASSVLEYWLKRRDGLVSEKEAFEGVIENLVNHARRVRK
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggagagatacctggtaccgaagccctcggattcggatgcgagatcaccgtcgcacagt
ccagagttaaatgagcggggtctaaaggagggaatctctaccgatgcagatgttcccgaa
acagtcctccaaagagtagatactttaccgaatgaagatacaggatcaagtccacgagca
catcaaagacgaccgagcgatgccttgcccgacgtgacggaaactgttccagatggccca
gatgcaccgtcaccgttgcaagatagcctcccgcaacagagtcatgataagcaggaaaca
cctgtggccggcgacgatagcgcaaaccaggcggctacagatgactttgatgattttgcg
gaggaacaagacatgggggaagatgacttcggtgattttgacgatttcgatgatggtttc
caagagcccagtacagaggtttctgatgaggaacccgtggtacaaacacctcaacttcat
acactacctacagttccaccccttgtggattttgattcttgtcaatcacttcccgatgtg
tttgctgcccttgacgaacctcttgaccgtctctttcccgcttccaatgaggtttcatca
ctccctcccatagaaccactccgaaacaactcagctatcttcaacactgaacgctctttg
tcattgtggtctcagcttgttgcgcctccaccactacagccccagaattgggtaaaatct
cggatccgtcgtctcttcctagtctcgctaggagtacctgtcgatctcgacgagatcttg
ccagcttcgaaacaaaagaagcttgttttgccatcaatcaaccccggtggccccgacgcc
acttcggggactcattcccgctcgggaagccaagtcaggaaagatgacgttcagagtggt
gccaacagtccgtcgacgtctggcccacctcggaatagagcttcatggcgacgcgaaccg
tctccaccgccccaattagacctcccagccgtccggcgcctatgctccacgacagacgca
gccctagatggactcacggatggcgaattacaaggccacgtgaaggagctggaaaatgtt
acgctccgtgctagctctgtcctcgaatactggctgaaacgacgagacggcctagtaagt
gagaaagaagcgttcgagggcgtgattgagaaccttgtcaatcacgccaggcgtgtgaga
aaataa

DBGET integrated database retrieval system